DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sc2 and F19H6.4

DIOPT Version :9

Sequence 1:NP_647836.2 Gene:Sc2 / 38457 FlyBaseID:FBgn0035471 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_510077.1 Gene:F19H6.4 / 184699 WormBaseID:WBGene00008959 Length:243 Species:Caenorhabditis elegans


Alignment Length:229 Identity:56/229 - (24%)
Similarity:87/229 - (37%) Gaps:38/229 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 LGPQIGWKTVFLAEYAGPLIVYLIFYFR--PELVYGKAASLPISLTTHIAAGCYTVHYVKRLLET 141
            :.|::.|   |:.|  .|.....::|.|  |            |.:.:.....:..||..|.|  
 Worm    42 INPKLAW---FIQE--APAFFIPLYYLRRGP------------SNSGYELNAAFLFHYFFRAL-- 87

  Fly   142 IFVHRFSHATMPLRNLFKNCTYYWGFTAYVS------YHVNHPQFTSPCMCTVWGALGAFALCEL 200
            |:..|....|.....:....|::..:..::.      |....|..|...:.::....|.:.    
 Worm    88 IYPCRIRSTTKSPVAIVAAATFFCAYNGFLQGYWNAFYQPEEPWTTRKLVGSLMYCTGMYI---- 148

  Fly   201 GNFSVHIALRNLRPPGTKVRKIPVADGNPLTKLFDLVSCPNYTYEIGAWVSFSVLTSCLAAYLFA 265
             |......||.||..|....|||..      .|::.:|||||..||..|:.:|:|...|.|..||
 Worm   149 -NHKSDTILRELRADGGTGYKIPTG------FLYEYISCPNYAGEIMEWIGYSILAWNLPALAFA 206

  Fly   266 FAGAFQMTIWALAKHRNYKKEFKDYPRQRRSIFP 299
            ......:...|:|.|:.||:.|..||..||.:.|
 Worm   207 IFTIANIGPRAVAHHKWYKETFPGYPPNRRILIP 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sc2NP_647836.2 Tsc13_N 3..79 CDD:176396 56/229 (24%)
PLN02560 15..299 CDD:178174 55/227 (24%)
PEMT 150..302 CDD:304400 41/156 (26%)
F19H6.4NP_510077.1 Steroid_dh 97..243 CDD:251363 41/155 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.802101 Normalized mean entropy S1292
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.