DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubi-p63E and Ubqln4

DIOPT Version :10

Sequence 1:NP_523909.2 Gene:Ubi-p63E / 38456 FlyBaseID:FBgn0003943 Length:763 Species:Drosophila melanogaster
Sequence 2:NP_277068.1 Gene:Ubqln4 / 94232 MGIID:2150152 Length:596 Species:Mus musculus


Alignment Length:109 Identity:33/109 - (30%)
Similarity:51/109 - (46%) Gaps:13/109 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 RGGMQIFVKTLTGKTITLEVEPSD--TIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136
            |..:::.|||...|.   |:...|  :::..|.:|..:.....||..||||||.|:||.|||.:.
Mouse    10 RPQIRVTVKTPKDKE---EIVICDQASVKEFKEEISRRFKAQQDQLVLIFAGKILKDGDTLSQHG 71

  Fly   137 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA 180
            |:...|:|||::.....|        ..:|....|..|.::..|
Mouse    72 IKDGLTVHLVIKTPQKAQ--------DPVTAAASPPSTPDSASA 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubi-p63ENP_523909.2 Ubl_ubiquitin 1..76 CDD:340501 1/1 (100%)
Ubl_ubiquitin 77..152 CDD:340501 27/76 (36%)
Ubl_ubiquitin 153..228 CDD:340501 5/28 (18%)
Ubl_ubiquitin 229..304 CDD:340501
Ubl_ubiquitin 305..380 CDD:340501
Ubl_ubiquitin 381..456 CDD:340501
Ubl_ubiquitin 457..532 CDD:340501
Ubl_ubiquitin 533..608 CDD:340501
Ubl_ubiquitin 609..684 CDD:340501
Ubl_ubiquitin 685..760 CDD:340501
Ubqln4NP_277068.1 Ubl_PLICs 11..83 CDD:340506 27/74 (36%)
rad23 13..>259 CDD:273167 32/106 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..148 5/27 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..361
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 482..528
UBA_PLICs 553..592 CDD:270582
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.