DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ubi-p63E and Ubl7

DIOPT Version :9

Sequence 1:	NP_001261383.1	Gene:	Ubi-p63E / 38456	FlyBaseID:	FBgn0003943	Length:	763	Species:	Drosophila melanogaster
Sequence 2:	NP_001116345.1	Gene:	Ubl7 / 69459	MGIID:	1916709	Length:	380	Species:	Mus musculus

Alignment Length:	118	Identity:	33/118 - (27%)
Similarity:	48/118 - (40%)	Gaps:	52/118 - (44%)

- Green bases have known domain annotations that are detailed below.

  Fly    55 TLSDYNIQKESTLHLVLRLR----------------------GGMQI-FVKTLTGKTITLEVEPS 96
            :|||:        ||.::|.                      ||..| |:|.|
Mouse     2 SLSDW--------HLAVKLADQPLAPKSILQLPETELGEYSLGGYSISFLKQL------------ 46

  Fly    97 DTIENVKAKIQDKEGIP-PDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR 148
                 :..|:|  |.:| |:...||:.|::|:|.:||..|.||..||:| |||
Mouse    47 -----IAGKLQ--ESVPDPELIDLIYCGRKLKDDQTLDFYGIQPGSTVH-VLR 91

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ubi-p63E	NP_001261383.1	Ubiquitin	1..76	CDD:176398	6/42 (14%)
		UBQ	1..72	CDD:214563	5/16 (31%)
		Ubiquitin	77..152	CDD:176398	25/74 (34%)
		UBQ	77..148	CDD:214563	23/72 (32%)
		Ubiquitin	153..228	CDD:176398
		UBQ	153..224	CDD:214563
		Ubiquitin	229..304	CDD:176398
		UBQ	229..300	CDD:214563
		Ubiquitin	305..380	CDD:176398
		UBQ	305..376	CDD:214563
		Ubiquitin	381..456	CDD:176398
		UBQ	381..452	CDD:214563
		Ubiquitin	457..532	CDD:176398
		UBQ	457..528	CDD:214563
		Ubiquitin	533..608	CDD:176398
		UBQ	533..604	CDD:214563
		Ubiquitin	609..684	CDD:176398
		UBQ	609..680	CDD:214563
		Ubiquitin	685..760	CDD:176398
		UBQ	685..756	CDD:214563
Ubl7	NP_001116345.1	Ubl_UBL7	7..98	CDD:340513	30/105 (29%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	200..313
		UBA_UBL7	<346..375	CDD:270511
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5272
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900