DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ubi-p63E and UBQLN3

DIOPT Version :9

Sequence 1:	NP_001261383.1	Gene:	Ubi-p63E / 38456	FlyBaseID:	FBgn0003943	Length:	763	Species:	Drosophila melanogaster
Sequence 2:	NP_001334025.1	Gene:	UBQLN3 / 50613	HGNCID:	12510	Length:	655	Species:	Homo sapiens

Alignment Length:	81	Identity:	27/81 - (33%)
Similarity:	43/81 - (53%)	Gaps:	8/81 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly    68 HLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL 132
            ||:       ::.|||...|. ...|..:.||:.:|.:|..:....|||..||||||.|:|..:|
Human    20 HLI-------KVTVKTPKDKE-DFSVTDTCTIQQLKEEISQRFKAHPDQLVLIFAGKILKDPDSL 76

  Fly   133 SDYNIQKESTLHLVLR 148
            :...::...|:|||::
Human    77 AQCGVRDGLTVHLVIK 92

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ubi-p63E	NP_001261383.1	Ubiquitin	1..76	CDD:176398	2/7 (29%)
		UBQ	1..72	CDD:214563	2/3 (67%)
		Ubiquitin	77..152	CDD:176398	25/72 (35%)
		UBQ	77..148	CDD:214563	25/70 (36%)
		Ubiquitin	153..228	CDD:176398
		UBQ	153..224	CDD:214563
		Ubiquitin	229..304	CDD:176398
		UBQ	229..300	CDD:214563
		Ubiquitin	305..380	CDD:176398
		UBQ	305..376	CDD:214563
		Ubiquitin	381..456	CDD:176398
		UBQ	381..452	CDD:214563
		Ubiquitin	457..532	CDD:176398
		UBQ	457..528	CDD:214563
		Ubiquitin	533..608	CDD:176398
		UBQ	533..604	CDD:214563
		Ubiquitin	609..684	CDD:176398
		UBQ	609..680	CDD:214563
		Ubiquitin	685..760	CDD:176398
		UBQ	685..756	CDD:214563
UBQLN3	NP_001334025.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	102..124
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	277..330
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	364..399
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	412..447
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5272
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900