powered by:
Protein Alignment Ubi-p63E and ubl7b
DIOPT Version :9
Sequence 1: | NP_001261383.1 |
Gene: | Ubi-p63E / 38456 |
FlyBaseID: | FBgn0003943 |
Length: | 763 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_005173742.1 |
Gene: | ubl7b / 393331 |
ZFINID: | ZDB-GENE-040426-1334 |
Length: | 371 |
Species: | Danio rerio |
Alignment Length: | 62 |
Identity: | 19/62 - (30%) |
Similarity: | 29/62 - (46%) |
Gaps: | 9/62 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 EPSDT------IENVK--AKIQDKEGIP-PDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70
||.|. :..:| ..:|..:.:| ||....:..|..|:|..||..|.|:..||||::
Zfish 26 EPGDVHPGGYQVSTLKQLISVQLSDSLPDPDLIDFVHCGCVLKDDLTLDSYGIKSGSTLHII 87
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5272 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.