DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubi-p63E and Ubqln4

DIOPT Version :10

Sequence 1:NP_523909.2 Gene:Ubi-p63E / 38456 FlyBaseID:FBgn0003943 Length:763 Species:Drosophila melanogaster
Sequence 2:NP_001101158.1 Gene:Ubqln4 / 310633 RGDID:1308273 Length:595 Species:Rattus norvegicus


Alignment Length:112 Identity:35/112 - (31%)
Similarity:55/112 - (49%) Gaps:3/112 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 RGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 138
            |..:::.|||...|...|..:.: :::..|.:|..:.....||..||||||.|:||.||:.:.|:
  Rat    10 RPQIRVTVKTPKDKEEILICDQA-SVKEFKEEISRRFKAQQDQLVLIFAGKILKDGDTLNQHGIK 73

  Fly   139 KESTLHLVLRLRGGMQIFVKTLTGKTITLE--VEPSDTIENVKAKIQ 183
            ...|:|||::.....|..|.|......|.:  ..||.|..:..|.:|
  Rat    74 DGLTVHLVIKTPQKAQDPVTTTASSPSTPDSASAPSTTPASPAAPVQ 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubi-p63ENP_523909.2 Ubl_ubiquitin 1..76 CDD:340501 1/1 (100%)
Ubl_ubiquitin 77..152 CDD:340501 25/74 (34%)
Ubl_ubiquitin 153..228 CDD:340501 9/33 (27%)
Ubl_ubiquitin 229..304 CDD:340501
Ubl_ubiquitin 305..380 CDD:340501
Ubl_ubiquitin 381..456 CDD:340501
Ubl_ubiquitin 457..532 CDD:340501
Ubl_ubiquitin 533..608 CDD:340501
Ubl_ubiquitin 609..684 CDD:340501
Ubl_ubiquitin 685..760 CDD:340501
Ubqln4NP_001101158.1 Ubl_PLICs 11..83 CDD:340506 25/72 (35%)
PRK10856 <84..>151 CDD:236776 9/37 (24%)
STI1 186..234 CDD:450205
STI1 216..260 CDD:450205
STI1 <371..407 CDD:450205
UBA_PLICs 552..591 CDD:270582
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.