DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ubi-p63E and Rad23b

DIOPT Version :9

Sequence 1:	NP_001261383.1	Gene:	Ubi-p63E / 38456	FlyBaseID:	FBgn0003943	Length:	763	Species:	Drosophila melanogaster
Sequence 2:	NP_001020446.1	Gene:	Rad23b / 298012	RGDID:	1562958	Length:	415	Species:	Rattus norvegicus

Alignment Length:	112	Identity:	30/112 - (26%)
Similarity:	59/112 - (52%)	Gaps:	8/112 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPDQQRLIFAGKQLEDGRTLSDYNIQ 62
            ||:.:|||..:|..::::|.:|::.:|.||:.::|   .|...|:||:|||.|.|...|.:|.|.
  Rat     1 MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILSDDTALKEYKID 65

  Fly    63 KESTLHLVLRLRGGMQIFVKTLTGK-----TITLEVEPSDTIENVKA 104
            :::.:.:::.....:...|...|.:     |.|:...|:..:....|
  Rat    66 EKNFVVVMVTKPKAVTSAVPATTQQSSSPSTTTVSSSPAAAVAQAPA 112

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ubi-p63E	NP_001261383.1	Ubiquitin	1..76	CDD:176398	24/77 (31%)
		UBQ	1..72	CDD:214563	24/73 (33%)
		Ubiquitin	77..152	CDD:176398	6/33 (18%)
		UBQ	77..148	CDD:214563	6/33 (18%)
		Ubiquitin	153..228	CDD:176398
		UBQ	153..224	CDD:214563
		Ubiquitin	229..304	CDD:176398
		UBQ	229..300	CDD:214563
		Ubiquitin	305..380	CDD:176398
		UBQ	305..376	CDD:214563
		Ubiquitin	381..456	CDD:176398
		UBQ	381..452	CDD:214563
		Ubiquitin	457..532	CDD:176398
		UBQ	457..528	CDD:214563
		Ubiquitin	533..608	CDD:176398
		UBQ	533..604	CDD:214563
		Ubiquitin	609..684	CDD:176398
		UBQ	609..680	CDD:214563
		Ubiquitin	685..760	CDD:176398
		UBQ	685..756	CDD:214563
Rad23b	NP_001020446.1	rad23	1..413	CDD:273167	30/112 (27%)
		RAD23_N	1..78	CDD:176400	24/76 (32%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	80..175		6/33 (18%)
		MSA-2c	<125..186	CDD:289042
		UBA1_Rad23	189..228	CDD:270560
		XPC-binding	276..331	CDD:286376
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	334..355
		UBA2_HR23B	371..415	CDD:270611
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5272
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900