| Sequence 1: | NP_001261383.1 | Gene: | Ubi-p63E / 38456 | FlyBaseID: | FBgn0003943 | Length: | 763 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_035984.2 | Gene: | Oasl2 / 23962 | MGIID: | 1344390 | Length: | 508 | Species: | Mus musculus |
| Alignment Length: | 266 | Identity: | 58/266 - (21%) |
|---|---|---|---|
| Similarity: | 101/266 - (37%) | Gaps: | 71/266 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 59 YNIQKESTLH-LVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFA 122
Fly 123 GKQLEDGRTLSDYNIQKESTLHL---------------VLRLRGGMQIFVKTLTGKTITLEVEPS 172
Fly 173 DTIENVKAKIQDKEGI----------PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG 227
Fly 228 GMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE 292
Fly 293 STLHLV 298 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Ubi-p63E | NP_001261383.1 | Ubiquitin | 1..76 | CDD:176398 | 6/17 (35%) |
| UBQ | 1..72 | CDD:214563 | 5/13 (38%) | ||
| Ubiquitin | 77..152 | CDD:176398 | 11/89 (12%) | ||
| UBQ | 77..148 | CDD:214563 | 9/85 (11%) | ||
| Ubiquitin | 153..228 | CDD:176398 | 18/84 (21%) | ||
| UBQ | 153..224 | CDD:214563 | 18/80 (23%) | ||
| Ubiquitin | 229..304 | CDD:176398 | 22/70 (31%) | ||
| UBQ | 229..300 | CDD:214563 | 22/70 (31%) | ||
| Ubiquitin | 305..380 | CDD:176398 | |||
| UBQ | 305..376 | CDD:214563 | |||
| Ubiquitin | 381..456 | CDD:176398 | |||
| UBQ | 381..452 | CDD:214563 | |||
| Ubiquitin | 457..532 | CDD:176398 | |||
| UBQ | 457..528 | CDD:214563 | |||
| Ubiquitin | 533..608 | CDD:176398 | |||
| UBQ | 533..604 | CDD:214563 | |||
| Ubiquitin | 609..684 | CDD:176398 | |||
| UBQ | 609..680 | CDD:214563 | |||
| Ubiquitin | 685..760 | CDD:176398 | |||
| UBQ | 685..756 | CDD:214563 | |||
| Oasl2 | NP_035984.2 | NT_2-5OAS_ClassI-CCAase | 29..214 | CDD:143390 | |
| OAS1_C | 170..352 | CDD:371041 | 16/105 (15%) | ||
| Ubl1_OASL | 355..428 | CDD:340509 | 18/78 (23%) | ||
| Ubiquitin_like_fold | 434..505 | CDD:391949 | 22/71 (31%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5272 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||