DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubi-p63E and gldi-6

DIOPT Version :10

Sequence 1:NP_523909.2 Gene:Ubi-p63E / 38456 FlyBaseID:FBgn0003943 Length:763 Species:Drosophila melanogaster
Sequence 2:NP_001379680.1 Gene:gldi-6 / 182679 WormBaseID:WBGene00015851 Length:141 Species:Caenorhabditis elegans


Alignment Length:74 Identity:20/74 - (27%)
Similarity:28/74 - (37%) Gaps:24/74 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 EMEALYLQMKKEEEQE------------EQVKGMNLKKRKQRG-----------EKKKKGETG-R 303
            |.|.||..:||:...|            .:::...||::.:.|           .|.||..|| |
 Worm    27 EEELLYYYLKKKVSYEPIDLDVIREVDLNKLEPWELKEKCRIGSGPQNEWYFFSHKDKKYPTGTR 91

  Fly   304 YMMAFALGF 312
            ...|.|.||
 Worm    92 TNRATAAGF 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubi-p63ENP_523909.2 Ubl_ubiquitin 1..76 CDD:340501
Ubl_ubiquitin 77..152 CDD:340501
Ubl_ubiquitin 153..228 CDD:340501
Ubl_ubiquitin 229..304 CDD:340501 15/64 (23%)
Ubl_ubiquitin 305..380 CDD:340501 4/8 (50%)
Ubl_ubiquitin 381..456 CDD:340501
Ubl_ubiquitin 457..532 CDD:340501
Ubl_ubiquitin 533..608 CDD:340501
Ubl_ubiquitin 609..684 CDD:340501
Ubl_ubiquitin 685..760 CDD:340501
gldi-6NP_001379680.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.