Sequence 1: | NP_001261383.1 | Gene: | Ubi-p63E / 38456 | FlyBaseID: | FBgn0003943 | Length: | 763 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_494548.1 | Gene: | C16C8.11 / 173690 | WormBaseID: | WBGene00015849 | Length: | 214 | Species: | Caenorhabditis elegans |
Alignment Length: | 205 | Identity: | 41/205 - (20%) |
---|---|---|---|
Similarity: | 91/205 - (44%) | Gaps: | 34/205 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE 92
Fly 93 VEPSDTIENVKAK--------IQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRL 149
Fly 150 RGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 214
Fly 215 KESTLHLVLR 224 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ubi-p63E | NP_001261383.1 | Ubiquitin | 1..76 | CDD:176398 | 10/47 (21%) |
UBQ | 1..72 | CDD:214563 | 9/43 (21%) | ||
Ubiquitin | 77..152 | CDD:176398 | 12/82 (15%) | ||
UBQ | 77..148 | CDD:214563 | 11/78 (14%) | ||
Ubiquitin | 153..228 | CDD:176398 | 18/72 (25%) | ||
UBQ | 153..224 | CDD:214563 | 17/70 (24%) | ||
Ubiquitin | 229..304 | CDD:176398 | |||
UBQ | 229..300 | CDD:214563 | |||
Ubiquitin | 305..380 | CDD:176398 | |||
UBQ | 305..376 | CDD:214563 | |||
Ubiquitin | 381..456 | CDD:176398 | |||
UBQ | 381..452 | CDD:214563 | |||
Ubiquitin | 457..532 | CDD:176398 | |||
UBQ | 457..528 | CDD:214563 | |||
Ubiquitin | 533..608 | CDD:176398 | |||
UBQ | 533..604 | CDD:214563 | |||
Ubiquitin | 609..684 | CDD:176398 | |||
UBQ | 609..680 | CDD:214563 | |||
Ubiquitin | 685..760 | CDD:176398 | |||
UBQ | 685..756 | CDD:214563 | |||
C16C8.11 | NP_494548.1 | COG5391 | <9..>111 | CDD:227680 | 17/90 (19%) |
UBQ | 149..212 | CDD:214563 | 17/64 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5272 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |