DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubi-p63E and LOC1273370

DIOPT Version :10

Sequence 1:NP_523909.2 Gene:Ubi-p63E / 38456 FlyBaseID:FBgn0003943 Length:763 Species:Drosophila melanogaster
Sequence 2:XP_061508771.1 Gene:LOC1273370 / 1273370 VectorBaseID:AGAMI1_014146 Length:989 Species:Anopheles gambiae


Alignment Length:80 Identity:17/80 - (21%)
Similarity:36/80 - (45%) Gaps:17/80 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 FGDSSDF--SCDT----------KWWLKGSTGFDEEVTNSF--LEDTKCKKLHEFVDLIGIREEE 103
            |.:.|:|  :||:          :.|::|:....:.:|..|  :.:.:..:...|.::...|:||
Mosquito   205 FSNCSEFIVTCDSFSIKDLNILVRQWIRGAIPSLKSITIRFRNITENRFDECALFKEIEYTRKEE 269

  Fly   104 DYS---FISKKADAT 115
            ..|   |..::.|.|
Mosquito   270 VQSVKRFTIERHDGT 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubi-p63ENP_523909.2 Ubl_ubiquitin 1..76 CDD:340501 7/34 (21%)
Ubl_ubiquitin 77..152 CDD:340501 10/44 (23%)
Ubl_ubiquitin 153..228 CDD:340501
Ubl_ubiquitin 229..304 CDD:340501
Ubl_ubiquitin 305..380 CDD:340501
Ubl_ubiquitin 381..456 CDD:340501
Ubl_ubiquitin 457..532 CDD:340501
Ubl_ubiquitin 533..608 CDD:340501
Ubl_ubiquitin 609..684 CDD:340501
Ubl_ubiquitin 685..760 CDD:340501
LOC1273370XP_061508771.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.