DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr63a and Gr59f

DIOPT Version :9

Sequence 1:NP_001137883.1 Gene:Gr63a / 38453 FlyBaseID:FBgn0035468 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster


Alignment Length:409 Identity:80/409 - (19%)
Similarity:169/409 - (41%) Gaps:48/409 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 ASNNPEF--KPSVFYRNIDPINWFLRIIGVL----PI-VRHGPARAKFEMNSASFIYSVVFFVLL 119
            :|.||::  :....||.:    ::|.:|.||    || :..|.....:.:...|::.......:|
  Fly    20 SSFNPQYAERYKELYRTL----FWLLLISVLANTAPITILPGCPNRFYRLVHLSWMILWYGLFVL 80

  Fly   120 ACYVGY--VANNRIHIVRSLSGPFEEAVIAYLFLVNILPIMIIPILWYEARKIA-KLFNDWDDFE 181
            ..|..:  |...|:.:.|.|:     |:.:.:::|:|..||   :|.::.|..| ||..:....:
  Fly    81 GSYWEFVLVTTQRVSLDRYLN-----AIESAIYVVHIFSIM---LLTWQCRNWAPKLMTNIVTSD 137

  Fly   182 V-LYYQISGHSLPLKLRQKAVYIAIVLPILSVLSVVITH---VTMSDLNINQVVPYCILDNLTAM 242
            : ..|.|..:.....:|.: :::..:...|::...:.||   |..|.|:||..|...|:.:::. 
  Fly   138 LNRAYTIDCNRTKRFIRLQ-LFLVGIFACLAIFFNIWTHKFVVYRSILSINSYVMPNIISSISF- 200

  Fly   243 LGAWWFLICEAMSITAHLLAERFQKALKHIGPAAM--VADYRVLWLRLSKLTRDTGNALCYTFVF 305
              |.::|:.:.::.....|.|..::.|.|:....:  |...|:....|...|:.......|:.:.
  Fly   201 --AQYYLLLQGIAWRQRRLTEGLERELTHLHSPRISEVQKIRMHHANLIDFTKAVNRTFQYSILL 263

  Fly   306 MSLYLFFIITLSIYGLMSQLSEGFGIKDIGLTITALWNIGLLFY------ICDEAHYASVNVRTN 364
            :.:..|....|.:: |:.|     ||::..:.....|...||:.      :|...|: :.:::..
  Fly   264 LFVGCFLNFNLVLF-LVYQ-----GIENPSMADFTKWVCMLLWLAMHVGKVCSILHF-NQSIQNE 321

  Fly   365 FQKKL-LMVELNWMNSDAQTEINMFLRATEMNPSTINCGGFFDVNRTLFKGLLTTMVTYLVVLLQ 428
            ....| |:..:::...|.|..|..|:.....|.......|..:::......||.....:.:.|||
  Fly   322 HSTCLTLLSRVSYARKDIQDTITHFIIQMRTNVRQHVVCGVINLDLKFLTTLLVASADFFIFLLQ 386

  Fly   429 FQISIPTDKGDSEGANNIT 447
            :.::........:|  |:|
  Fly   387 YDVTYEALSKSVQG--NVT 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr63aNP_001137883.1 7tm_7 79..433 CDD:285581 72/374 (19%)
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 65/345 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.