DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr63a and Gr57a

DIOPT Version :9

Sequence 1:NP_001137883.1 Gene:Gr63a / 38453 FlyBaseID:FBgn0035468 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_523798.1 Gene:Gr57a / 37347 FlyBaseID:FBgn0041240 Length:416 Species:Drosophila melanogaster


Alignment Length:406 Identity:80/406 - (19%)
Similarity:147/406 - (36%) Gaps:111/406 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 GPARAKFEMNSASFIYSV-VFFVLLACYVGYVA--------NNRI----HIVRSLSGPFEEAVIA 147
            |..|:.|.::.||.|||: |......|..|.::        ..|:    ::|.|:|. .|..:..
  Fly    33 GIRRSTFRISWASRIYSMSVAIAAFCCLFGSLSVLLAEEDIRERLAKADNLVLSISA-LELLMST 96

  Fly   148 YLFLVNILPIMI-----IPILWYEARKIAKLFNDWDDFEVLYYQISGHSLPLK--LRQKAVYIAI 205
            .:|.|.::.:.:     :.|....|...|:|.:|:           |.:|..:  ||:....:.|
  Fly    97 LVFGVTVISLQVFARRHLGIYQRLAALDARLMSDF-----------GANLNYRKMLRKNIAVLGI 150

  Fly   206 VLPI-LSVLSVVITHVTMSD--LNINQVVPYCILDNLTAMLGAWWFLICEAMSITAHLLAERFQ- 266
            |..| |..::.....|....  |.:...:.|.|:.......|.....:.|.:.|...||.:..| 
  Fly   151 VTTIYLMAINSAAVQVASGHRALFLLFALCYTIVTGGPHFTGYVHMTLAEMLGIRFRLLQQLLQP 215

  Fly   267 KALKHIGPAAMVADYRV------------------------LWLRLS-KLTRDTGNALCYTFVFM 306
            :.|....|...|.:.|:                        ||..:: .|...|.          
  Fly   216 EFLNWRFPQLHVQELRIRQVVSMIQELHYLIQEINRVYALSLWAAMAHDLAMSTS---------- 270

  Fly   307 SLYLFFIITLSIYGLMSQLSEGFGIKDIG----LTITALWNIGLLFYICDEAHYASVNVRTNFQK 367
            .||:.|..::.| |..::...|...:.:|    :.|..|:.:.:..:.||...|.:       ::
  Fly   271 ELYILFGQSVGI-GQQNEEENGSCYRMLGYLALVMIPPLYKLLIAPFYCDRTIYEA-------RR 327

  Fly   368 KLLMVEL--NWMNSDAQTEINMFLRATEMNP-----------STINCGGFFDV--NRTLFKGLLT 417
            .|.:||.  :|           |.:.:.:.|           :.|......||  :|.:. ||.|
  Fly   328 CLRLVEKLDDW-----------FPQKSSLRPLVESLMSWRIQAKIQFTSGLDVVLSRKVI-GLFT 380

  Fly   418 T-MVTYLVVLLQFQIS 432
            : :|.||::|:||.::
  Fly   381 SILVNYLLILIQFAMT 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr63aNP_001137883.1 7tm_7 79..433 CDD:285581 80/406 (20%)
Gr57aNP_523798.1 7tm_7 32..397 CDD:303125 80/406 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.