DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr63a and Gr43a

DIOPT Version :9

Sequence 1:NP_001137883.1 Gene:Gr63a / 38453 FlyBaseID:FBgn0035468 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_001286158.1 Gene:Gr43a / 35655 FlyBaseID:FBgn0041243 Length:453 Species:Drosophila melanogaster


Alignment Length:408 Identity:81/408 - (19%)
Similarity:142/408 - (34%) Gaps:100/408 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 PARAKFEMNSASF-------IYSVVFFVLLACYVGYVANNRIHIVRSLSGPFEEAVIAY------ 148
            |.||.|.|.||:.       :..||..::...|.|..:.|....:.......:..:.||      
  Fly    68 PVRASFRMKSATSKVVTALDVSVVVMAIVSGVYCGLFSLNDTLELNDRLNKIDNTLNAYNNFRRD 132

  Fly   149 ------LFLVNILPIMIIPIL----WYEARKIAKLFN-DWDDFEV-LYYQISGHSLPLKLRQKAV 201
                  :..|::|.|.|:..|    |   .:||:..| ...|.|: :::.|..:||         
  Fly   133 RWRALGMAAVSLLAISILVGLDVGTW---MRIAQDMNIAQSDTELNVHWYIPFYSL--------- 185

  Fly   202 YIAIVLPILSVLSVVITHV-----------------------------------TMSDLNINQ-V 230
            |.     ||:.|.|.|.:.                                   |:.::::|: .
  Fly   186 YF-----ILTGLQVNIANTAYGLGRRFGRLNRMLSSSFLAENNATSAIKPQKVSTVKNVSVNRPA 245

  Fly   231 VPYCILDNLTAMLGAWWFLICEAMSITAHLLAERFQKALKHIG--PA--------AMVADYRVLW 285
            :|..:..:||.:.|.  .|..||....|...:......|..:|  ||        ::...:..|.
  Fly   246 MPSALHASLTKLNGE--TLPSEAAGDKAAARSLILNVELLKLGYFPAKNKGLLLKSLADSHESLG 308

  Fly   286 LRLSKLTRDTGNALCYTFVFMSLYLFFIITLSIYGLMSQLSEGFGIKDIGLTITALW---NIGLL 347
            ..:..|:...|.|:.:..|...|:|..........|:|:...|:      |.:..||   :...|
  Fly   309 KCVHLLSNSFGIAVLFILVSCLLHLVATAYFLFLELLSKRDNGY------LWVQMLWICFHFLRL 367

  Fly   348 FYICDEAHYASVNVRTNFQKKLLMVELNWMNSDAQTEINMFLRATEMNPSTINCGGFFDVNRTLF 412
            ..:.:..|.|:...|...| .:..:|...........:..|.:...:..:..:..|...||||:.
  Fly   368 LMVVEPCHLAARESRKTIQ-IVCEIERKVHEPILAEAVKKFWQQLLVVDADFSACGLCRVNRTIL 431

  Fly   413 KGLLTTMVTYLVVLLQFQ 430
            ....:.:.||||:|:|||
  Fly   432 TSFASAIATYLVILIQFQ 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr63aNP_001137883.1 7tm_7 79..433 CDD:285581 81/408 (20%)
Gr43aNP_001286158.1 7tm_7 10..449 CDD:285581 79/406 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.