DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr63a and Gr32a

DIOPT Version :10

Sequence 1:NP_001137883.1 Gene:Gr63a / 38453 FlyBaseID:FBgn0035468 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_523543.3 Gene:Gr32a / 34545 FlyBaseID:FBgn0041246 Length:461 Species:Drosophila melanogaster


Alignment Length:71 Identity:15/71 - (21%)
Similarity:28/71 - (39%) Gaps:16/71 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 IDKIKGLATKTLNEIN------------GLYKKRP-ELKRALDECSRRYKT---ILNADVPEAIE 110
            |.|:..||.:.:.|..            ||....| :.:..|..|...:|:   ::||...|.::
  Fly   135 IGKLLDLAKRVVPEAKLSQTPLVLKATAGLRLLPPAQAEALLAACRELFKSSGFLVNAQAVEIMD 199

  Fly   111 AISKGV 116
            ...:|:
  Fly   200 GTDEGI 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr63aNP_001137883.1 7tm_7 79..433 CDD:462463 9/42 (21%)
Gr32aNP_523543.3 7tm_7 57..449 CDD:462463 15/71 (21%)

Return to query results.
Submit another query.