DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr63a and Gr8a

DIOPT Version :9

Sequence 1:NP_001137883.1 Gene:Gr63a / 38453 FlyBaseID:FBgn0035468 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster


Alignment Length:416 Identity:74/416 - (17%)
Similarity:141/416 - (33%) Gaps:114/416 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 INWFLRIIGV-----LPIVRHG-PARAKFEMNSAS-FIYSVVFFVLLAC--------YVGYV--- 126
            :.:.||:..|     ||:...| |||.:..:.:.| |:...:..::|||        |.|.:   
  Fly     9 LQFHLRLYQVLGFHGLPLPGDGNPARTRRRLMAWSLFLLISLSALVLACLFSGEEFLYRGDMFGC 73

  Fly   127 ANNRIHIVRSLSGPFEEAVIAYLFLVNILPIMIIPILWYEARKIAKLFNDWDDFEVLYYQISGH- 190
            ||:.:..|      |.|..:..::|..:.....:...|:                 |::::.|. 
  Fly    74 ANDALKYV------FAELGVLAIYLETLSSQRHLANFWW-----------------LHFKLGGQK 115

  Fly   191 ----SLPLKLRQKAVYIAIVLPILSVLSVVITHVTMSDLNINQVVPYCILDNLTA-MLGAW---- 246
                ||..:.:|...|:..:..:::  :.|..|:.:.....           ||. ||..|    
  Fly   116 TGLVSLRSEFQQFCRYLIFLYAMMA--AEVAIHLGLWQFQA-----------LTQHMLLFWSTYE 167

  Fly   247 ---WFLICEAMSITAH--LLAERFQKALKHIGPAAMVADYRVLWLRLSKLTRDTGNAL------- 299
               |......:....|  ||.|:.....:.:|   ::|:|       |:...:||.:.       
  Fly   168 PLVWLTYLRNLQFVLHLELLREQLTGLEREMG---LLAEY-------SRFASETGRSFPGFESFL 222

  Fly   300 -------------------CYTFVFMSLYLFFIITLSI------YGLMSQLSEGFGIKDIGLTIT 339
                               |:...|....|..::|::|      |.:...:.......|..|.:.
  Fly   223 RRRLVQKQRIYSHVYDMLKCFQGAFNFSILAVLLTINIRIAVDCYFMYYSIYNNVINNDYYLIVP 287

  Fly   340 ALWNIGLLFYICDEAHYASVNVRTNFQKKLLMVELNWMN-SDAQTEINMFLRATEMNPSTINCGG 403
            ||..|....|.....  ..|..|...|...::.:....: .|...:|..|.......|..|:|.|
  Fly   288 ALLEIPAFIYASQSC--MVVVPRIAHQLHNIVTDSGCCSCPDLSLQIQNFSLQLLHQPIRIDCLG 350

  Fly   404 FFDVNRTLFKGLLTTMVTYLVVLLQF 429
            ...::.:|...:..::.||::..:||
  Fly   351 LTILDCSLLTRMACSVGTYMIYSIQF 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr63aNP_001137883.1 7tm_7 79..433 CDD:285581 74/416 (18%)
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 72/414 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.