DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr63a and Gr9a

DIOPT Version :9

Sequence 1:NP_001137883.1 Gene:Gr63a / 38453 FlyBaseID:FBgn0035468 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster


Alignment Length:348 Identity:73/348 - (20%)
Similarity:131/348 - (37%) Gaps:70/348 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 IYSVVFFVLLAC-YVGYVANNRIHIVRSLSGPFEEAVIAYLFLVNILPIMIIPILWYEARKIAKL 173
            :.|..|.||:.. .||     .|....:...|..|:|.||...|    ||.:.:.:       |:
  Fly    30 LLSSTFLVLILIELVG-----EIETYFTEENPDNESVPAYFAKV----IMGVNMAY-------KM 78

  Fly   174 FNDWDDFEVLY----YQISGHSLPLKLRQKAVYIAIVLPILSVLSVVITHVTMSDLNINQVVPYC 234
            .:.|.....|:    ::.....||.......:|..::|.|  :|......:.:|:..|..:    
  Fly    79 IHAWIALSALFECRRFRYLLEELPPVKATSFIYRHLILEI--ILFACNAFLVLSEYTIRGI---- 137

  Fly   235 ILDNLTAMLGAWWFLICEAMSITAHLLAERFQKALK--HIGPAAMVADYRVL---WLRLSKLTRD 294
            .|:||..   |:......|..:...:|.:|....|:  |....:..:||:.|   :..|:|:||.
  Fly   138 YLENLRY---AYSLQAVRARYLQMMVLVDRLDGKLEQLHHRVISGSSDYKTLRLDYAHLAKVTRS 199

  Fly   295 TG----------NALCY-------TFVFMSLYLFFI-ITLSIYGLMSQLSEGFGIKDIGLTITAL 341
            ..          |.||.       ...||..||..: .||.::|.:..:        :..|:..:
  Fly   200 LSHLFGLSLLLLNVLCLGDWIIVCNVYFMVAYLQVLPATLFLFGQVMFV--------VCPTLIKI 256

  Fly   342 WNIGLLFYICDEAHYASVNVRTNFQKKLLMVELNWMNSDAQTEINMFLRATEMNPSTINCGGFFD 406
            |:      ||..:| ..|:...:.|::|  .:|.......:::|..|......:|..|:..|.:.
  Fly   257 WS------ICAASH-RCVSKSKHLQQQL--KDLPGQTPVERSQIEGFALQIMQDPIQIDVCGIYH 312

  Fly   407 VNRTLFKGLLTTMVTYLVVLLQF 429
            :|.....|:...::..||:.|||
  Fly   313 LNLQTLAGMFFFILEALVIFLQF 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr63aNP_001137883.1 7tm_7 79..433 CDD:285581 73/348 (21%)
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 71/346 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.