DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr63a and Gr10a

DIOPT Version :9

Sequence 1:NP_001137883.1 Gene:Gr63a / 38453 FlyBaseID:FBgn0035468 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_727523.1 Gene:Gr10a / 117501 FlyBaseID:FBgn0045502 Length:408 Species:Drosophila melanogaster


Alignment Length:429 Identity:72/429 - (16%)
Similarity:146/429 - (34%) Gaps:135/429 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 RAKFEMNSASFIYSVVFFVLLACYVGYVANNRIHIVRSLSGPFEEAVIAYLFLVNILPIMIIPIL 163
            |.:|:......:|::::..::..||..         |:|....:..:|||..|.::|.|:::|  
  Fly    13 RHEFKFYRYGHVYALIYGQVVIDYVPQ---------RALKRGVKVLLIAYGHLFSMLLIVVLP-- 66

  Fly   164 WYEARKIAKLFNDWDDFEVLYYQISGHSLPLKLRQKAVYIAIVLPILSVLSVVITHV--TMSDLN 226
                           .:...:::....:|..:| |...|::.....:...:|::|:|  |:....
  Fly    67 ---------------GYFCYHFRTLTDTLDRRL-QLLFYVSFTNTAIKYATVIVTYVANTVHFEA 115

  Fly   227 INQ----------------------------VVPYCILDNLTAMLGAWWFLICEAMSITAHLLAE 263
            |||                            ...:|:: ||..|:     .:|...:....:...
  Fly   116 INQRCTMQRTHLEFEFKNAPQEPKRPFEFFMYFKFCLI-NLMMMI-----QVCGIFAQYGEVGKG 174

  Fly   264 RFQKALKHIGPAAMV--------AD------------YRVLWLRLSKLTRD------TGNALCYT 302
            ...:...|....|.|        ||            ||...|:|..| ||      .|..|.:.
  Fly   175 SVSQVRVHFAIYAFVLWNYTENMADYCYFINGSVLKYYRQFNLQLGSL-RDEMDGLRPGGMLLHH 238

  Fly   303 FVFMS----------------------LYLFFIITLSIYGLMSQLSEGF---------GIKDIG- 335
            ...:|                      ::.|.:|.|.:..|::.|:..:         .::::. 
  Fly   239 CCELSDRLEELRRRCREIHDLQRESFRMHQFQLIGLMLSTLINNLTNFYTLFHMLAKQSLEEVSY 303

  Fly   336 -LTITALWNIGLLFYICDEAHYASVNVRTNFQKKLL------MVELNWMNSDAQTEI-NMFLRAT 392
             :.:.:::..|  ||| |....|.:|.....:.:.:      ..|...|:.....|| ::.|...
  Fly   304 PVVVGSVYATG--FYI-DTYIVALINEHIKLELEAVALTMRRFAEPREMDERLTREIEHLSLELL 365

  Fly   393 EMNPSTINCGGFFDVNRTLFKGLLTTMVTYLVVLLQFQI 431
            ...|..: | |...::|.|...:..|..:|.:.|:||.:
  Fly   366 NYQPPML-C-GLLHLDRRLVYLIAVTAFSYFITLVQFDL 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr63aNP_001137883.1 7tm_7 79..433 CDD:285581 72/429 (17%)
Gr10aNP_727523.1 7tm_7 20..402 CDD:285581 70/420 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.