DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr63a and Gr22b

DIOPT Version :9

Sequence 1:NP_001137883.1 Gene:Gr63a / 38453 FlyBaseID:FBgn0035468 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_001014456.1 Gene:Gr22b / 117492 FlyBaseID:FBgn0045500 Length:386 Species:Drosophila melanogaster


Alignment Length:404 Identity:76/404 - (18%)
Similarity:147/404 - (36%) Gaps:101/404 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 NWFLRIIGVLPIVRHGPARAK-FEMNSASFIYSVVF-FVLLACYVGYVANNRIHIVRSLS-GPFE 142
            :|   ::|:.|.......|.: ...:....:|.:|. :.|:...:......|.|.:.:.. .|..
  Fly    24 SW---LLGIFPFTLDSGKRIRQLRRSRCLTLYGLVLNYFLIFTLIRLAFEYRKHKLEAFKRNPVL 85

  Fly   143 EAVIAYLFLVNILPIMIIPIL-WYEARKIAKLFN-----DWDDFEVLYYQISGHSLPLKLRQKAV 201
            |.:...:.::|:|..:|:..: ::.:||:.::.|     ::.|||.|    :|.:.|      ..
  Fly    86 EMINVVIGIINVLSALIVHFMNFWGSRKVGEICNELLILEYQDFEGL----NGRNCP------NF 140

  Fly   202 YIAIVLPILSVLSVVITHVTMS------DLNINQVVPYCILD---NLTAMLGAWWFLICEAMSIT 257
            ...::...|::|..:::..|::      :.:|..|:..|:::   ||..|               
  Fly   141 NCFVIQKCLTILGQLLSFFTLNFALPGLEFHICLVLLSCLMEFSLNLNIM--------------- 190

  Fly   258 AHLLAERFQKALKHIGPAAMVADYRVLWL-------RLSKLTRDTGNALCYTFVFMSLY------ 309
             |.          |:|   ::..||.:||       .:|:|..:..........|:|||      
  Fly   191 -HY----------HVG---VLLIYRYVWLINEQLKDLVSQLKLNPETDFSRIHQFLSLYKRLLEL 241

  Fly   310 -------------LFFIITLS----------IYGLMSQLSEGFGIKDIGLTITALWNIGLLFYIC 351
                         ||.|..||          :|||..:....|.:......:..:|:..|....|
  Fly   242 NRKLVIAYEYQMTLFIIAQLSGNIVVIYFLIVYGLSMRTYSIFLVAFPNSLLINIWDFWLCIAAC 306

  Fly   352 DEAHYASVNVRTNFQKKLLMVELNWMNSDAQTEINMFLRATEMNPSTINCGGFFDVN-RTLFKGL 415
            |....|........:   :..:|...:...:..:|.|..............|.|.:| |..||.:
  Fly   307 DLTEKAGDETAIILK---IFSDLEHRDDKLEMSVNEFAWLCSHRKFRFQLCGLFSMNCRMGFKMI 368

  Fly   416 LTTMVTYLVVLLQF 429
            :||.: |||.|:||
  Fly   369 ITTFL-YLVYLVQF 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr63aNP_001137883.1 7tm_7 79..433 CDD:285581 76/404 (19%)
Gr22bNP_001014456.1 7tm_7 17..385 CDD:285581 76/404 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.