DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr63a and Gr59a

DIOPT Version :9

Sequence 1:NP_001137883.1 Gene:Gr63a / 38453 FlyBaseID:FBgn0035468 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_726287.2 Gene:Gr59a / 117485 FlyBaseID:FBgn0045483 Length:367 Species:Drosophila melanogaster


Alignment Length:283 Identity:56/283 - (19%)
Similarity:96/283 - (33%) Gaps:123/283 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 IYSVVFFVLLACYVGYVANNRIHIVRSLSGPFEEAVIA--YLFLVNILPIMIIPILWYEARKIAK 172
            :|:|  |:.:..|            .::.|.|.::.|.  |..|:|.:.:.::|..::   |.||
  Fly    10 VYAV--FIGMTSY------------ETMGGKFRQSRITRIYCLLINAIFLTLLPSAFW---KSAK 57

  Fly   173 LFN--DWDDFEVLYYQISGHSLPLKLRQKAVYIAIVLPILSVLSVVITHVTMSDLNINQVVPY-- 233
            |.:  ||              :|..:|                                |.||  
  Fly    58 LLSTADW--------------MPSYMR--------------------------------VTPYIM 76

  Fly   234 CILDNLTAMLGAWWFLICEAMSITAHLLAERFQKALKHIGPAAMVADYRVLWLRLSKLTRDTG-- 296
            |.: |..|:               |:.|..|..:       .||:.|.:.:.|.:::....||  
  Fly    77 CTI-NYAAI---------------AYTLISRCYR-------DAMLMDLQRIVLEVNREMLRTGKK 118

  Fly   297 -NALCYTFVFMSLY------LFFIITLSIYGLMSQ----LSEGFGIKDIGLTI---------TAL 341
             |:|.....|:..:      |.:|:.:.||...:|    |..|. :.:|.|||         |:|
  Fly   119 MNSLLRRMFFLKTFTLTYSCLSYILAVFIYQWKAQNWSNLCNGL-LVNISLTILFVNTFFYFTSL 182

  Fly   342 WNIGLLFYICDEAHYASVNVRTN 364
            |:|.        ..|..||.:.|
  Fly   183 WHIA--------RGYDFVNQQLN 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr63aNP_001137883.1 7tm_7 79..433 CDD:285581 56/283 (20%)
Gr59aNP_726287.2 7tm_7 7..363 CDD:285581 56/283 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.