DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr63a and Gr93b

DIOPT Version :9

Sequence 1:NP_001137883.1 Gene:Gr63a / 38453 FlyBaseID:FBgn0035468 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_732664.2 Gene:Gr93b / 117472 FlyBaseID:FBgn0045470 Length:395 Species:Drosophila melanogaster


Alignment Length:394 Identity:68/394 - (17%)
Similarity:140/394 - (35%) Gaps:124/394 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 MNSASFIY-SVVFFVLLACYVGYVANNRIHIVRSLSGPFEEAVIAYLFLVNILPIMIIPIL---- 163
            :|...::: .:|..:|.:|:.||..:       :.||.:|:..:...|...::..:|..::    
  Fly    51 INRRGYLWICLVIRLLASCFYGYSYD-------AWSGQYEDMYLRAFFGFRLIGCLICSVIILVM 108

  Fly   164 --WYEARKIAKLFNDWDDFEVLYYQISG--HSLPLKLRQKAVYIAIVLPILSVLSVVITHVTMSD 224
              |:.    .:|.|..:.|..|:.::..  :|...:...:|.::.:...:.|:|.|.:.      
  Fly   109 QFWFG----EELINLVNRFLQLFRRMQSLTNSPKNRFGDRAEFLLMFSKVFSLLFVFMA------ 163

  Fly   225 LNINQVVPYCILDNLTAMLGAWWF--LICEAMSITAHLLAERFQKALKHIGPAAMVADYRVLWLR 287
                          ...||..|:.  |:|:..:               .:|...:.....|.:|.
  Fly   164 --------------FRLMLSPWFLLTLVCDLYT---------------SVGTGMITHLCFVGYLS 199

  Fly   288 LSKLTRDTGNAL----------------------------------C-YTF--------VFMSLY 309
            :..|.||..|.:                                  | |.:        .|..|:
  Fly   200 IGVLYRDLNNYVDCQLRAQLRSLNGENNSFRNNPQPTRQAISNLDKCLYLYDEIHQVSRSFQQLF 264

  Fly   310 ---LFF-----IITLSIYGLMSQLSEGFGIKDIGLTITALWNIGLLFYICDEAHYASVNVRTNFQ 366
               ||.     ::.:|:....:.|...:.....||.|..|.::.||          :::|.:...
  Fly   265 DLPLFLSLAQSLLAMSMVSYHAILRRQYSFNLWGLVIKLLIDVVLL----------TMSVHSAVN 319

  Fly   367 KKLLMVELNWMN---SDAQT---EINMFLRATEMNPSTINCGGFFDVNRTLFKGLLTTMVTYLVV 425
            ...|:..|::.|   :|:|:   ::.:||...:.....:...|.|:|:..|....|:.||||||.
  Fly   320 GSRLIRRLSFENFYVTDSQSYHQKLELFLGRLQHQELRVFPLGLFEVSNELTLFFLSAMVTYLVF 384

  Fly   426 LLQF 429
            |:|:
  Fly   385 LVQY 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr63aNP_001137883.1 7tm_7 79..433 CDD:285581 68/394 (17%)
Gr93bNP_732664.2 7tm_7 24..391 CDD:285581 68/394 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.