DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr63a and Gr22f

DIOPT Version :9

Sequence 1:NP_001137883.1 Gene:Gr63a / 38453 FlyBaseID:FBgn0035468 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_722729.2 Gene:Gr22f / 117349 FlyBaseID:FBgn0041249 Length:378 Species:Drosophila melanogaster


Alignment Length:406 Identity:80/406 - (19%)
Similarity:137/406 - (33%) Gaps:106/406 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 WFLR--------IIGVLPIVRHGPARAKFEMNSASFIYSVVFFVLLACYV-----------GYVA 127
            ||:.        ::|:.|.. ....|.:.:.:....:|..|...|..|..           .|.|
  Fly    16 WFMLQTTLYASWLLGLFPFT-FDSRRKQLKRSRWLLLYGFVLHSLAMCLAMSSHLASKQRRKYNA 79

  Fly   128 NNRIHIVRSLSGPFEEAVIAYLFLVNILPIMIIPILWYE--ARKIAK----LFNDWDDFEVL--- 183
            ..|..::..:...|:   :...|.:::|.:|.:   |..  .||||.    |.....|...|   
  Fly    80 FERNPLLEKIYMQFQ---VTTFFTISVLLLMNV---WKSNTVRKIANELLTLEGQVKDLLTLKNC 138

  Fly   184 ----YYQISGHSLPLKLRQKAVYIAI--------VLPILSVLSVVITHVTMSDLNINQVVPYCIL 236
                .:.|..|...:.....::|..:        :|.||..|..|...:.:...:...::.|   
  Fly   139 PNFNCFVIKKHVAAIGQFVISIYFCLCQENSYPKILKILCCLPSVGLQLIIMHFHTEIILVY--- 200

  Fly   237 DNLTAMLGAWWFLICEAMSITAHLLAERFQKALKHIGPAAMVADYRVLWLRLSKLTRDTGNALC- 300
                    .:.:|:.|.:..:.||.:.|..         |:.:.|..| |:||:|.     ..| 
  Fly   201 --------RYVWLVNETLEDSHHLSSSRIH---------ALASLYDRL-LKLSELV-----VACN 242

  Fly   301 --YTFVFMSLYL-------FFIITLS-------IYGLMS-QLSEGFGIKDIGLTITALWNIGLLF 348
              ...:.:.:||       ||:|.|.       ||.:.| ||            |...|:..|..
  Fly   243 DLQLILMLIIYLIGNTVQIFFLIVLGVSMNKRYIYLVASPQL------------IINFWDFWLNI 295

  Fly   349 YICDEAHYASVNVRTNFQKKLLMVELNWMNSDAQTEINMFLRATEMNPSTINCGGFFDVNRTLFK 413
            .:||.|  .....:|:...| |..:|...:.:.:..:|.|..............|.|.:|..:..
  Fly   296 VVCDLA--GKCGDQTSKVLK-LFTDLEHDDEELERSLNEFAWLCTHRKFRFQLCGLFSINHNMGF 357

  Fly   414 GLLTTMVTYLVVLLQF 429
            .::.|...|||.||||
  Fly   358 QMIITSFLYLVYLLQF 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr63aNP_001137883.1 7tm_7 79..433 CDD:285581 80/406 (20%)
Gr22fNP_722729.2 7tm_7 19..377 CDD:285581 78/403 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.