DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Awh and LPXN

DIOPT Version :9

Sequence 1:NP_001261379.1 Gene:Awh / 38451 FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001137467.1 Gene:LPXN / 9404 HGNCID:14061 Length:391 Species:Homo sapiens


Alignment Length:174 Identity:42/174 - (24%)
Similarity:60/174 - (34%) Gaps:62/174 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CAACGEPISDRFFLEVGGCSWH------AHCL---------------------------RCCMCM 39
            ||:|.:||:.: .:...|.|||      .||.                           ||..|.
Human   157 CASCQKPIAGK-VIHALGQSWHPEHFVCTHCKEEIGSSPFFERSGLAYCPNDYHQLFSPRCAYCA 220

  Fly    40 CP-LDR------------------------QQSCFIRERQVYCKADYSKNFGAKCSKCCRGISAS 79
            .| ||:                        .:....::::.||:.|:...|..||..|.|.:..:
Human   221 APILDKVLTAMNQTWHPEHFFCSHCGEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLEN 285

  Fly    80 DWVRRARELVFHLACFACDQCGRQLSTGEQFALMDDRVLCKAHY 123
              ...|.:.|:|..||.|..|....|||..|.| |.|..|:.||
Human   286 --YLSAMDTVWHPECFVCGDCFTSFSTGSFFEL-DGRPFCELHY 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759 19/110 (17%)
LIM2_AWH 69..123 CDD:188765 18/53 (34%)
Homeobox 152..204 CDD:278475
LPXNNP_001137467.1 LIM1_Leupaxin 155..209 CDD:188790 11/52 (21%)
LIM2_Leupaxin 216..267 CDD:188792 7/50 (14%)
LIM3_Leupaxin 275..327 CDD:188794 20/55 (36%)
LIM4_Paxillin_like 334..385 CDD:188725
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.