DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Awh and PDLIM7

DIOPT Version :9

Sequence 1:	NP_001261379.1	Gene:	Awh / 38451	FlyBaseID:	FBgn0013751	Length:	287	Species:	Drosophila melanogaster
Sequence 2:	NP_005442.2	Gene:	PDLIM7 / 9260	HGNCID:	22958	Length:	457	Species:	Homo sapiens

Alignment Length:	116	Identity:	42/116 - (36%)
Similarity:	55/116 - (47%)	Gaps:	3/116 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly     7 SCAACGEPISDRFFLEVGGCSWHAHCLRCCMCMCPLDRQQSCFIRERQVYCKADYSKNFGAKCSK 71
            |||.|.:.|:.. .:.....:||.||..|..|..|: |.::.::.|...||:.||.|.||.||..
Human   340 SCAKCKKKITGE-IMHALKMTWHVHCFTCAACKTPI-RNRAFYMEEGVPYCERDYEKMFGTKCHG 402

  Fly    72 CCRGISASDWVRRARELVFHLACFACDQCGRQLSTGEQFALMDDRVLCKAH 122
            |...|.|.|....|....:|..||.|..|...|. |:.|....||.|||:|
Human   403 CDFKIDAGDRFLEALGFSWHDTCFVCAICQINLE-GKTFYSKKDRPLCKSH 452

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Awh	NP_001261379.1	LIM1_AWH	8..61	CDD:188759	15/52 (29%)
		LIM2_AWH	69..123	CDD:188765	20/54 (37%)
		Homeobox	152..204	CDD:278475
PDLIM7	NP_005442.2	PDZ_signaling	5..79	CDD:238492
		Atrophin-1	<81..254	CDD:331285
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	82..142
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	176..226
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	239..258
		LIM1_Enigma	282..333	CDD:188836
		LIM2_Enigma	341..392	CDD:188840	15/52 (29%)
		LIM3_Enigma	400..454	CDD:188842	20/54 (37%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R6207
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.940