DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Awh and PDLIM1

DIOPT Version :9

Sequence 1:NP_001261379.1 Gene:Awh / 38451 FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_066272.1 Gene:PDLIM1 / 9124 HGNCID:2067 Length:329 Species:Homo sapiens


Alignment Length:59 Identity:19/59 - (32%)
Similarity:28/59 - (47%) Gaps:3/59 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 CSKCCRGISASDWVRRARELVFHLACFACDQCGRQLSTGEQFALMDDRVLCKAHYLETV 127
            |.||..|| ...:| :.|:...|..|:.|..||..|.....| .::|::.|:.|..|.|
Human   260 CDKCGTGI-VGVFV-KLRDRHRHPECYVCTDCGTNLKQKGHF-FVEDQIYCEKHARERV 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759
LIM2_AWH 69..123 CDD:188765 16/53 (30%)
Homeobox 152..204 CDD:278475
PDLIM1NP_066272.1 PDZ_signaling 10..82 CDD:238492
DUF4749 138..230 CDD:318205
LIM_CLP36 260..311 CDD:188832 16/53 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.