DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Awh and LHX4

DIOPT Version :9

Sequence 1:NP_001261379.1 Gene:Awh / 38451 FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_203129.1 Gene:LHX4 / 89884 HGNCID:21734 Length:390 Species:Homo sapiens


Alignment Length:228 Identity:91/228 - (39%)
Similarity:131/228 - (57%) Gaps:25/228 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ELRSCAACGEPISDRFFLEVGGCSWHAHCLRCCMCMCPL-DRQQSCFIRERQVYCKADYSKNFGA 67
            ::..||.|.:.|.|:|.|:|....||:.||:|..|...| ||   ||.|...||||.|:.|.||.
Human    26 QIPQCAGCNQHILDKFILKVLDRHWHSSCLKCADCQMQLADR---CFSRAGSVYCKEDFFKRFGT 87

  Fly    68 KCSKCCRGISASDWVRRARELVFHLACFACDQCGRQLSTGEQFALMDD-RVLCKAHYLETVEGGT 131
            ||:.|.:||..:..||:|::.|:||.||||..|.|||:||::|.||:| |::||..| ||.:...
Human    88 KCTACQQGIPPTQVVRKAQDFVYHLHCFACIICNRQLATGDEFYLMEDGRLVCKEDY-ETAKQND 151

  Fly   132 TSSDEGCDGDGYHKSKTKRVRTTFTEEQLQVLQANFQIDSNPDGQDLERIASVTGLSKRVTQVWF 196
            .|           ::..||.|||.|.:||:.|:..::....|.....|:::|.|||..||.||||
Human   152 DS-----------EAGAKRPRTTITAKQLETLKNAYKNSPKPARHVREQLSSETGLDMRVVQVWF 205

  Fly   197 QNSRARQKK-HIHAGKNK-------IREPEGSS 221
            ||.||::|: ...||:::       ::...|||
Human   206 QNRRAKEKRLKKDAGRHRWGQFYKSVKRSRGSS 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759 24/53 (45%)
LIM2_AWH 69..123 CDD:188765 27/54 (50%)
Homeobox 152..204 CDD:278475 23/51 (45%)
LHX4NP_203129.1 LIM1_Lhx4 30..81 CDD:188852 24/53 (45%)
LIM2_Lhx3_Lhx4 89..144 CDD:188762 27/54 (50%)
Homeobox 160..213 CDD:306543 23/52 (44%)
Interaction with DNA. /evidence=ECO:0000305|PubMed:28473536 161..181 7/19 (37%)
Interaction with 5-mCpG DNA. /evidence=ECO:0000305|PubMed:28473536 199..211 9/11 (82%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 230..253 3/9 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 356..390
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.