DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Awh and PXL1

DIOPT Version :9

Sequence 1:NP_001261379.1 Gene:Awh / 38451 FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_013016.4 Gene:PXL1 / 853965 SGDID:S000001798 Length:706 Species:Saccharomyces cerevisiae


Alignment Length:143 Identity:38/143 - (26%)
Similarity:59/143 - (41%) Gaps:21/143 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CAACG-EPISDRFFL----EVGGCSWHAHCLRCCMCMCPLDRQQSCFIRERQVYCKADYSKNFGA 67
            |.||| |....|.|.    |:.| .||..|.:|..|....::...|:|...:.||:..|.:...:
Yeast   556 CRACGLEVTGKRMFSKKENELSG-QWHRECFKCIECGIKFNKHVPCYILGDEPYCQKHYHEENHS 619

  Fly    68 KCSKCCRGISA----SDWVRRARELVFHLACFACDQCGRQLSTGEQFALMDDRVLCKAHYLET-- 126
            .|..|...|..    :|.|.|     ||:.|..|..| :...|.:.:....:..||..|.:|.  
Yeast   620 ICKVCSNFIEGECLENDKVER-----FHVDCLNCFLC-KTAITNDYYIFNGEIPLCGNHDMEALL 678

  Fly   127 ---VEGGTTSSDE 136
               ::..|:|:|:
Yeast   679 KEGIDNATSSNDK 691

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759 18/57 (32%)
LIM2_AWH 69..123 CDD:188765 14/57 (25%)
Homeobox 152..204 CDD:278475
PXL1NP_013016.4 LIM1_UF1 556..614 CDD:188783 18/58 (31%)
LIM 621..672 CDD:259829 14/56 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.