DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Awh and PHO2

DIOPT Version :9

Sequence 1:NP_001261379.1 Gene:Awh / 38451 FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_010177.1 Gene:PHO2 / 851452 SGDID:S000002264 Length:559 Species:Saccharomyces cerevisiae


Alignment Length:95 Identity:28/95 - (29%)
Similarity:47/95 - (49%) Gaps:10/95 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 VEGGTTSSDEGCDGDGYHKSKTKRVRTTFTEEQLQVLQANFQIDSNPDGQDLERIASVTGLSKRV 191
            :...:.:||.|       ..:.||.|.  ..|.|.||:..|:|:..|...:.::|:.:.|:.::.
Yeast    65 MSASSNASDSG-------PQRPKRTRA--KGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKN 120

  Fly   192 TQVWFQNSRARQKKHIHAGKNKIREPEGSS 221
            .::||||.||:.:|..| |.||...|...|
Yeast   121 VRIWFQNRRAKLRKKQH-GSNKDTIPSSQS 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759
LIM2_AWH 69..123 CDD:188765
Homeobox 152..204 CDD:278475 16/51 (31%)
PHO2NP_010177.1 COG5576 53..183 CDD:227863 28/95 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.