DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Awh and HAT3

DIOPT Version :9

Sequence 1:NP_001261379.1 Gene:Awh / 38451 FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_191598.1 Gene:HAT3 / 825210 AraportID:AT3G60390 Length:315 Species:Arabidopsis thaliana


Alignment Length:90 Identity:30/90 - (33%)
Similarity:45/90 - (50%) Gaps:11/90 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 DRVLCKAHYLETVEGGTTSSDEGCDGDGYHKSKTKRVRTTFTEEQLQVLQANFQIDSNPDGQDLE 179
            :|..|      ::.||  |.||...|:|...|: |::|  .::||..||:..|:..|..:.:...
plant   137 ERASC------SLGGG--SDDEDGSGNGDDSSR-KKLR--LSKEQALVLEETFKEHSTLNPKQKM 190

  Fly   180 RIASVTGLSKRVTQVWFQNSRARQK 204
            .:|....|..|..:|||||.|||.|
plant   191 ALAKQLNLRTRQVEVWFQNRRARTK 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759
LIM2_AWH 69..123 CDD:188765 2/7 (29%)
Homeobox 152..204 CDD:278475 18/51 (35%)
HAT3NP_191598.1 HD-ZIP_N 19..118 CDD:398351
Homeobox 165..215 CDD:395001 18/51 (35%)
HALZ 217..260 CDD:128634
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.