DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Awh and Zfhx4

DIOPT Version :9

Sequence 1:	NP_001261379.1	Gene:	Awh / 38451	FlyBaseID:	FBgn0013751	Length:	287	Species:	Drosophila melanogaster
Sequence 2:	NP_001355600.1	Gene:	Zfhx4 / 80892	MGIID:	2137668	Length:	3607	Species:	Mus musculus

Alignment Length:	83	Identity:	40/83 - (48%)
Similarity:	53/83 - (63%)	Gaps:	3/83 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly   124 LETVEGGTTSSDEGCD-GDGYHKSKTKRVRTTFTEEQLQVLQANFQIDSNPDGQDLERIASVTGL 187
            ||..|....|..||.: |:..|:.  ||:|||.|.|||::|...:.:||||..:.|:.||...||
Mouse  2576 LEDKEDNNCSEKEGGNSGEDQHRD--KRLRTTITPEQLEILYEKYLLDSNPTRKMLDHIAREVGL 2638

  Fly   188 SKRVTQVWFQNSRARQKK 205
            .|||.||||||:|||::|
Mouse  2639 KKRVVQVWFQNTRARERK 2656

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Awh	NP_001261379.1	LIM1_AWH	8..61	CDD:188759
		LIM2_AWH	69..123	CDD:188765
		Homeobox	152..204	CDD:278475	29/51 (57%)
Zfhx4	NP_001355600.1	C2H2 Zn finger	613..634	CDD:275368
		C2H2 Zn finger	644..665	CDD:275368
		C2H2 Zn finger	699..716	CDD:275368
		C2H2 Zn finger	1396..1416	CDD:275371
		C2H2 Zn finger	1424..1441	CDD:275371
		SFP1	<1468..1608	CDD:227516
		C2H2 Zn finger	1540..1564	CDD:275368
		C2H2 Zn finger	1592..1610	CDD:275368
		COG5576	2098..2237	CDD:227863
		HOX	2127..2182	CDD:197696
		Homeobox	2226..2280	CDD:395001
		COG5576	2536..>2658	CDD:227863	40/83 (48%)
		Homeobox	2603..2656	CDD:395001	29/52 (56%)
		Homeobox	2926..2979	CDD:395001
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	1	1.000