DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Awh and ldb3a

DIOPT Version :9

Sequence 1:	NP_001261379.1	Gene:	Awh / 38451	FlyBaseID:	FBgn0013751	Length:	287	Species:	Drosophila melanogaster
Sequence 2:	XP_021336348.1	Gene:	ldb3a / 794339	ZFINID:	ZDB-GENE-040121-6	Length:	746	Species:	Danio rerio

Alignment Length:	142	Identity:	39/142 - (27%)
Similarity:	55/142 - (38%)	Gaps:	16/142 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly     8 CAACGEPISDRFFLEVGGCSWHAHCLRCCMCMCPLDRQQSCFIRER-QVYCKADYSKNFGAKCSK 71
            ||.|...|...|.:.:|. |||.....|..|...|  ....|:.|: .|||:..|.:.|...|::
Zfish   570 CATCNNIIRGPFLVALGR-SWHPEEFNCHYCHTSL--ADVSFVEEQNNVYCENCYEEFFAPTCAR 631

  Fly    72 CCRGISASDWVRRARELVFHLACFACDQCGRQLSTGEQFALMDDRVLCKAHYLETVEGGTTSSDE 136
            |...|...  |..|....:|..||.|..||:... ...|.:.|....|:..|:...    ::...
Zfish   632 CSTKIMGE--VMHALRQTWHTTCFVCAACGKPFG-NSLFHMEDGEPYCEKDYIALF----STKCH 689

  Fly   137 GCD-----GDGY 143
            |||     ||.:
Zfish   690 GCDFPVEAGDKF 701

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Awh	NP_001261379.1	LIM1_AWH	8..61	CDD:188759	17/53 (32%)
		LIM2_AWH	69..123	CDD:188765	14/53 (26%)
		Homeobox	152..204	CDD:278475
ldb3a	XP_021336348.1	PDZ_signaling	13..82	CDD:238492
		DUF4749	149..239	CDD:318205
		LIM1_ZASP_Cypher	570..621	CDD:188838	17/53 (32%)
		LIM2_Enigma_like	629..680	CDD:188748	14/53 (26%)
		LIM3_ZASP_Cypher	688..742	CDD:188844	5/14 (36%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R6207
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.030