DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Awh and SHOX

DIOPT Version :9

Sequence 1:	NP_001261379.1	Gene:	Awh / 38451	FlyBaseID:	FBgn0013751	Length:	287	Species:	Drosophila melanogaster
Sequence 2:	NP_000442.1	Gene:	SHOX / 6473	HGNCID:	10853	Length:	292	Species:	Homo sapiens

Alignment Length:	141	Identity:	47/141 - (33%)
Similarity:	61/141 - (43%)	Gaps:	26/141 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly   128 EGGTTSSDEG---C----------DGDGYHKSKTKRVRTTFTEEQLQVLQANFQIDSNPDGQDLE 179
            |.||....||   |          |.||..|.|.:|.||.||.|||..|:..|.....||....|
Human    84 EFGTARVAEGIYECKEKREDVKSEDEDGQTKLKQRRSRTNFTLEQLNELERLFDETHYPDAFMRE 148

  Fly   180 RIASVTGLSKRVTQVWFQNSRA---RQKKHIHAG-----KNKIREPEGSSFARHINL-QLTYSFQ 235
            .::...|||:...||||||.||   :|:..:|.|     .|.:   :....|.::|: .|...||
Human   149 ELSQRLGLSEARVQVWFQNRRAKCRKQENQMHKGVILGTANHL---DACRVAPYVNMGALRMPFQ 210

  Fly   236 NNAQNPMHLNG 246
             ..|..:.|.|
Human   211 -QVQAQLQLEG 220

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Awh	NP_001261379.1	LIM1_AWH	8..61	CDD:188759
		LIM2_AWH	69..123	CDD:188765
		Homeobox	152..204	CDD:278475	23/54 (43%)
SHOX	NP_000442.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..34
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	100..119		5/18 (28%)
		Homeobox	120..174	CDD:395001	23/53 (43%)
		SH3-binding. /evidence=ECO:0000255	242..249
		OAR	272..288	CDD:397759
		OAR. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00138	274..287
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R6207
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.940