DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Awh and CG34367

DIOPT Version :9

Sequence 1:NP_001261379.1 Gene:Awh / 38451 FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001097140.1 Gene:CG34367 / 5740879 FlyBaseID:FBgn0085396 Length:420 Species:Drosophila melanogaster


Alignment Length:91 Identity:33/91 - (36%)
Similarity:46/91 - (50%) Gaps:5/91 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 ETVEGGTTSSDEGCD--GDGYHKSKTKRVRTTFTEEQLQVLQANFQIDSNPDGQDLERIASVTGL 187
            |.|....:.:.|.||  ......:|.:|.||.||.:||..|:..|:....||....|.::...||
  Fly   167 ECVSPEPSRNREHCDPLDTSLVNTKQRRSRTNFTLDQLNELERLFEETHYPDAFMREELSQRLGL 231

  Fly   188 SKRVTQVWFQNSRARQKKH---IHAG 210
            |:...||||||.||:.:||   :|.|
  Fly   232 SEARVQVWFQNRRAKCRKHENQMHKG 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759
LIM2_AWH 69..123 CDD:188765
Homeobox 152..204 CDD:278475 22/51 (43%)
CG34367NP_001097140.1 Homeobox 195..248 CDD:278475 22/52 (42%)
OAR 392..409 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.