DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Awh and Pdlim5

DIOPT Version :9

Sequence 1:	NP_001261379.1	Gene:	Awh / 38451	FlyBaseID:	FBgn0013751	Length:	287	Species:	Drosophila melanogaster
Sequence 2:	XP_006501801.1	Gene:	Pdlim5 / 56376	MGIID:	1927489	Length:	734	Species:	Mus musculus

Alignment Length:	130	Identity:	40/130 - (30%)
Similarity:	50/130 - (38%)	Gaps:	21/130 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly     8 CAACGEPISDRFFL-EVGGC--------------SWHAHCLRCCMCMCPLDRQQSCFIRERQVYC 57
            |..|.|    :||. |.|.|              :||..|..|..|..|: |.....:.:.:.||
Mouse   605 CELCYE----KFFAPECGRCQRKILGEVINALKQTWHVSCFVCVACGKPI-RNNVFHLEDGEPYC 664

  Fly    58 KADYSKNFGAKCSKCCRGISASDWVRRARELVFHLACFACDQCGRQLSTGEQFALMDDRVLCKAH 122
            :.||...||..|..|...|.|.|....|....:|..||.|..|...|. |:.|....|:.|||.|
Mouse   665 ETDYYALFGTICRGCEFPIEAGDMFLEALGYTWHDTCFVCSVCCESLE-GQTFFSKKDKPLCKKH 728

Fly 123 122
Mouse 729 728

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Awh	NP_001261379.1	LIM1_AWH	8..61	CDD:188759	17/67 (25%)
		LIM2_AWH	69..123	CDD:188765	19/54 (35%)
		Homeobox	152..204	CDD:278475
Pdlim5	XP_006501801.1	PDZ_signaling	10..82	CDD:238492
		PHA03307	150..>540	CDD:223039
		DUF4749	214..315	CDD:374237
		LIM1_ENH	558..609	CDD:188837	1/3 (33%)
		LIM2_ENH	617..668	CDD:188841	11/51 (22%)
		LIM3_ENH	676..730	CDD:188843	19/54 (35%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R6207
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.030