DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Awh and LMO3

DIOPT Version :9

Sequence 1:NP_001261379.1 Gene:Awh / 38451 FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001230542.1 Gene:LMO3 / 55885 HGNCID:6643 Length:167 Species:Homo sapiens


Alignment Length:170 Identity:48/170 - (28%)
Similarity:74/170 - (43%) Gaps:44/170 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TELRSCAACGEPISDRFFLEVGGCSWHAHCLRCCMCMCPL-DRQQSCFIRERQVYCKA------- 59
            |:.:.||.|...|.||:.|:.....||..||:|..|.|.| :..:.|    ..:|..|       
Human     8 TKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEHLKRC----GSIYIHAAHTEIGI 68

  Fly    60 -------------DYSKN------FG--AKCSKCCRGISASDWVRRARELVFHLACFACDQCGRQ 103
                         |:|:.      ||  ..|:.|.:.|.|.:.|.||::.|:||.||||..|.::
Human    69 CVTLEWPLPFVIIDFSQQITIAWLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQR 133

  Fly   104 LSTGEQFALMDDRVLCKAHYLETVEGGTTSSDEGCDGDGY 143
            ...|::|.|.::.:||:..|           :||...:||
Human   134 FCVGDKFFLKNNMILCQTDY-----------EEGLMKEGY 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759 18/73 (25%)
LIM2_AWH 69..123 CDD:188765 20/53 (38%)
Homeobox 152..204 CDD:278475
LMO3NP_001230542.1 LIM 13..>49 CDD:295319 15/35 (43%)
LIM2_LMO1_LMO3 99..153 CDD:188775 20/53 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.