DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Awh and lmo3

DIOPT Version :9

Sequence 1:	NP_001261379.1	Gene:	Awh / 38451	FlyBaseID:	FBgn0013751	Length:	287	Species:	Drosophila melanogaster
Sequence 2:	NP_001315524.1	Gene:	lmo3 / 553774	ZFINID:	ZDB-GENE-050522-201	Length:	167	Species:	Danio rerio

Alignment Length:	144	Identity:	48/144 - (33%)
Similarity:	73/144 - (50%)	Gaps:	14/144 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly     3 TELRSCAACGEPISDRFFLEVGGCSWHAHCLRCCMCMCPLDRQQS-CFIRERQVYCKADYSKNFG 66
            |:.:.||.|...|.||:.|:.....||..||:|..|.|.|....| .:.:...:.|:.||.:.||
Zfish    30 TKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFG 94

  Fly    67 --AKCSKCCRGISASDWVRRARELVFHLACFACDQCGRQLSTGEQFALMDDRVLCKAHYLETVEG 129
              ..|:.|.:.|.|.:.|.||:|.|:||.||||..|.::...|::|.|.::.:||:..|
Zfish    95 VTGNCAACSKLIPAFEMVMRAKENVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDY------ 153

  Fly   130 GTTSSDEGCDGDGY 143
                 :||...:||
Zfish   154 -----EEGLMKEGY 162

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Awh	NP_001261379.1	LIM1_AWH	8..61	CDD:188759	17/53 (32%)
		LIM2_AWH	69..123	CDD:188765	21/53 (40%)
		Homeobox	152..204	CDD:278475
lmo3	NP_001315524.1	LIM1_LMO1_LMO3	35..89	CDD:188774	17/53 (32%)
lmo3	NP_001315524.1	LIM2_LMO1_LMO3	99..153	CDD:188775	21/53 (40%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910