DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Awh and pdlim5

DIOPT Version :9

Sequence 1:NP_001261379.1 Gene:Awh / 38451 FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster
Sequence 2:XP_012817118.2 Gene:pdlim5 / 548530 XenbaseID:XB-GENE-854114 Length:884 Species:Xenopus tropicalis


Alignment Length:148 Identity:39/148 - (26%)
Similarity:54/148 - (36%) Gaps:34/148 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SCAACGEPISDRFFLEVGG------------------C--------------SWHAHCLRCCMCM 39
            :||.|...:::..|:|..|                  |              :||..|..|..|.
 Frog   733 NCAHCKSSMAEMGFVEEKGGLYCEICYEKLFAPECARCQRKILGEVINALKQTWHVSCFVCVACQ 797

  Fly    40 CPLDRQQSCFIRERQVYCKADYSKNFGAKCSKCCRGISASDWVRRARELVFHLACFACDQCGRQL 104
            .|: |.....:.:.:.||:.||...||..|..|...|.|.|....|....:|..||.|..|...|
 Frog   798 TPI-RNSVFHLEDGEPYCETDYYSLFGTICHGCEFPIEAGDRFLEALGHTWHNTCFVCTICCENL 861

  Fly   105 STGEQFALMDDRVLCKAH 122
            . |:.|....|::|||.|
 Frog   862 E-GQTFFSKKDKLLCKKH 878

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759 16/84 (19%)
LIM2_AWH 69..123 CDD:188765 19/54 (35%)
Homeobox 152..204 CDD:278475
pdlim5XP_012817118.2 PDZ 10..83 CDD:214570
PRK14951 <80..216 CDD:237865
DUF4749 212..320 CDD:406377
LIM1_ENH 708..759 CDD:188837 6/25 (24%)
LIM2_Enigma_like 767..818 CDD:188748 10/51 (20%)
LIM3_ENH 826..880 CDD:188843 19/54 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.