DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Awh and PITX1

DIOPT Version :9

Sequence 1:NP_001261379.1 Gene:Awh / 38451 FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_002644.4 Gene:PITX1 / 5307 HGNCID:9004 Length:314 Species:Homo sapiens


Alignment Length:79 Identity:35/79 - (44%)
Similarity:45/79 - (56%) Gaps:7/79 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 GGTTSSDEGCDG--DGYHKSKTKRVRTTFTEEQLQVLQANFQIDSNPDGQDLERIASVTGLSKRV 191
            |||     ||.|  |...|.|.:|.||.||.:|||.|:|.||.:..||....|.||..|.|::..
Human    73 GGT-----GCGGADDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMREEIAVWTNLTEPR 132

  Fly   192 TQVWFQNSRARQKK 205
            .:|||:|.||:.:|
Human   133 VRVWFKNRRAKWRK 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759
LIM2_AWH 69..123 CDD:188765
Homeobox 152..204 CDD:278475 24/51 (47%)
PITX1NP_002644.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..103 16/34 (47%)
COG5576 36..>146 CDD:227863 34/77 (44%)
Homeobox 93..146 CDD:395001 24/52 (46%)
Interaction with PIT-1. /evidence=ECO:0000250 147..279 35/79 (44%)
OAR 276..293 CDD:397759
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 280..293
Nuclear localization signal. /evidence=ECO:0000255 286..290
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.