DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Awh and Lmo3

DIOPT Version :9

Sequence 1:NP_001261379.1 Gene:Awh / 38451 FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster
Sequence 2:XP_006237647.1 Gene:Lmo3 / 497798 RGDID:1561357 Length:156 Species:Rattus norvegicus


Alignment Length:144 Identity:47/144 - (32%)
Similarity:73/144 - (50%) Gaps:14/144 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TELRSCAACGEPISDRFFLEVGGCSWHAHCLRCCMCMCPLDRQQS-CFIRERQVYCKADYSKNFG 66
            |:.:.||.|...|.||:.|:.....||..||:|..|.|.|....| .:.:...:.|:.||.:.||
  Rat    19 TKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFG 83

  Fly    67 --AKCSKCCRGISASDWVRRARELVFHLACFACDQCGRQLSTGEQFALMDDRVLCKAHYLETVEG 129
              ..|:.|.:.|.|.:.|.||::.|:||.||||..|.::...|::|.|.::.:||:..|      
  Rat    84 VTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDY------ 142

  Fly   130 GTTSSDEGCDGDGY 143
                 :||...:||
  Rat   143 -----EEGLMKEGY 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759 17/53 (32%)
LIM2_AWH 69..123 CDD:188765 20/53 (38%)
Homeobox 152..204 CDD:278475
Lmo3XP_006237647.1 LIM1_LMO1_LMO3 24..78 CDD:188774 17/53 (32%)
LIM2_LMO1_LMO3 88..142 CDD:188775 20/53 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.