DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Awh and shox2

DIOPT Version :9

Sequence 1:NP_001261379.1 Gene:Awh / 38451 FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_957490.1 Gene:shox2 / 394171 ZFINID:ZDB-GENE-040426-1457 Length:299 Species:Danio rerio


Alignment Length:152 Identity:46/152 - (30%)
Similarity:67/152 - (44%) Gaps:20/152 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 EGGTTSSD--EGC---DGDGYHKSKTKRVRTTFTEEQLQVLQANFQIDSNPDGQDLERIASVTGL 187
            :|.|...:  |.|   :.:...|.|.:|.||.||.|||..|:..|.....||....|.::...||
Zfish    83 DGNTDMKERKEDCKPLEDETQTKIKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGL 147

  Fly   188 SKRVTQVWFQNSRA---RQKKHIHAGK--NKIREPEGSSFARHINL-QLTYSFQNNAQNPMHLNG 246
            |:...||||||.||   :|:..:|.|.  ....:.|....|.::|: .|...||.::    |.| 
Zfish   148 SEARVQVWFQNRRAKCRKQENQLHKGVLIGAASQFEACRVAPYVNVGALRMPFQQDS----HCN- 207

  Fly   247 SKAGLYPTHESSMDELSQDSSV 268
                :.|.......:|..||:|
Zfish   208 ----VPPFSFQVQAQLQLDSAV 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759
LIM2_AWH 69..123 CDD:188765
Homeobox 152..204 CDD:278475 23/54 (43%)
shox2NP_957490.1 Homeobox 111..164 CDD:278475 23/52 (44%)
OAR 278..294 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.