DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Awh and CG4328

DIOPT Version :9

Sequence 1:NP_001261379.1 Gene:Awh / 38451 FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_648567.2 Gene:CG4328 / 39405 FlyBaseID:FBgn0036274 Length:544 Species:Drosophila melanogaster


Alignment Length:271 Identity:90/271 - (33%)
Similarity:138/271 - (50%) Gaps:20/271 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ELRSCAACGEPISDRFFLEVGGCSWHAHCLRCCMCMCPLDRQQSCFIRERQVYCKADYSKNF-GA 67
            :|..||.|.:||.||:.:.|...|:|..||:|  ..|.|....||:.||.::||:.||.:.: ..
  Fly   195 QLSQCAHCCQPICDRYIMRVVENSFHEGCLKC--TACSLHLVHSCYAREGKLYCRVDYERLYIRN 257

  Fly    68 KCSKCCRGISASDWVRRARELVFHLACFACDQCGRQLSTGEQFALMDDRVLCKAHY---LETVEG 129
            .|..|...|:|.:.|.|..|.||||.||||..||..|..|||:.:...::.|:..|   :|.::|
  Fly   258 HCLGCGLKIAADELVMRCHENVFHLKCFACVVCGALLKKGEQYVVKQGQLFCRFDYEKEVEMLQG 322

  Fly   130 GTTSSDE----GCDGDGYHKSKTKRVRTTFTEEQLQVLQANFQIDSNPDGQDLERIASVTGLSKR 190
            .....||    ..||    :...||.||....:|.:..:|:|::...|..:..|.:|..||||.|
  Fly   323 YDFYGDELFPPKLDG----RRGPKRPRTILNTQQRRAFKASFEVSPKPCRKVRENLAKDTGLSLR 383

  Fly   191 VTQVWFQNSRARQKKHIHAGKNKIREP--EGSSFARHINLQLTYSFQNNAQNPMHLNGSKAGLYP 253
            :.||||||.||:.||   ..|...:||  :|:|.::.....|..|.....::..| :.|::.|..
  Fly   384 IVQVWFQNQRAKVKK---IQKKAKQEPPSKGASDSQDSQESLDSSLATKIKDEAH-SDSESQLES 444

  Fly   254 THESSMDELSQ 264
            .:.::.|.|::
  Fly   445 PYSTTSDGLTR 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759 21/52 (40%)
LIM2_AWH 69..123 CDD:188765 22/53 (42%)
Homeobox 152..204 CDD:278475 21/51 (41%)
CG4328NP_648567.2 LIM1_Lmx1b 199..251 CDD:188757 22/53 (42%)
LIM 259..313 CDD:295319 22/53 (42%)
COG5576 <332..439 CDD:227863 35/114 (31%)
HOX 341..393 CDD:197696 21/51 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I4481
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.