DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Awh and pdlim5b

DIOPT Version :9

Sequence 1:NP_001261379.1 Gene:Awh / 38451 FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_956490.1 Gene:pdlim5b / 393165 ZFINID:ZDB-GENE-040426-908 Length:628 Species:Danio rerio


Alignment Length:148 Identity:40/148 - (27%)
Similarity:55/148 - (37%) Gaps:34/148 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SCAACGEPISDRFFLEVGG------------------C--------------SWHAHCLRCCMCM 39
            :|:.|...::|..|:|..|                  |              :||.:|..|..|.
Zfish   477 TCSHCRSSLADVGFVEERGSVYCVLCYEEFLAPTCFQCHKKIIGEVINALKQTWHVNCFLCASCK 541

  Fly    40 CPLDRQQSCFIRERQVYCKADYSKNFGAKCSKCCRGISASDWVRRARELVFHLACFACDQCGRQL 104
            .|:. ..:..:.:||.||:.||...||..|..|...|.|.|....|....:|..||.|..|...|
Zfish   542 QPIG-NNTFHLEDRQPYCEKDYYSLFGTGCHGCDFPIEAGDKFLEALGFTWHDTCFVCAVCSTSL 605

  Fly   105 STGEQFALMDDRVLCKAH 122
            . |:.|....|:.|||.|
Zfish   606 E-GQTFFSKKDKPLCKKH 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759 17/84 (20%)
LIM2_AWH 69..123 CDD:188765 19/54 (35%)
Homeobox 152..204 CDD:278475
pdlim5bNP_956490.1 PDZ_signaling 11..80 CDD:238492
DUF4749 243..335 CDD:292558
LIM1_Enigma_like 452..503 CDD:188747 6/25 (24%)
LIM2_Enigma_like 511..562 CDD:188748 11/51 (22%)
LIM 570..624 CDD:295319 19/54 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.