DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Awh and eve

DIOPT Version :10

Sequence 1:NP_001261379.1 Gene:Awh / 38451 FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster


Alignment Length:57 Identity:18/57 - (31%)
Similarity:29/57 - (50%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 KRVRTTFTEEQLQVLQANFQIDSNPDGQDLERIASVTGLSKRVTQVWFQNSRARQKK 205
            :|.||.||.:||..|:..|..::.........:|:...|.:...:|||||.|.:.|:
  Fly    71 RRYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKR 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759
LIM2_AWH 69..123 CDD:188765
Homeodomain 149..205 CDD:459649 17/55 (31%)
eveNP_523670.2 Homeodomain 71..127 CDD:459649 17/55 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.