DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Awh and HOXB8

DIOPT Version :9

Sequence 1:NP_001261379.1 Gene:Awh / 38451 FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_076921.1 Gene:HOXB8 / 3218 HGNCID:5119 Length:243 Species:Homo sapiens


Alignment Length:175 Identity:36/175 - (20%)
Similarity:60/175 - (34%) Gaps:46/175 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ADYSKNFGAKCSKCCRGISASDWVRRARELVFHLACFACDQCGRQLSTGEQFALMDDRVLCKAHY 123
            |.|.:|   .|:..|.|...:              .:..|...||...|.|...:.....||.  
Human    67 APYQQN---PCAVACHGDPGN--------------FYGYDPLQRQSLFGAQDPDLVQYADCKL-- 112

  Fly   124 LETVEGGTTSSDEGCDGDGYHKSKT----------------KRVRTTFTEEQLQVLQANFQIDSN 172
                   ..:|..|.:.:|..:|.:                :|.|.|::..|...|:..|..:..
Human   113 -------AAASGLGEEAEGSEQSPSPTQLFPWMRPQAAAGRRRGRQTYSRYQTLELEKEFLFNPY 170

  Fly   173 PDGQDLERIASVTGLSKRVTQVWFQNSRARQKKHIHAGKNKIREP 217
            ...:....::...||::|..::||||.|.:.||.    .||.:.|
Human   171 LTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKE----NNKDKFP 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759 1/1 (100%)
LIM2_AWH 69..123 CDD:188765 10/53 (19%)
Homeobox 152..204 CDD:278475 13/51 (25%)
HOXB8NP_076921.1 Antp-type hexapeptide 134..139 0/4 (0%)
Homeobox 150..203 CDD:395001 13/52 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..243 4/13 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.