DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Awh and CG11294

DIOPT Version :10

Sequence 1:NP_001261379.1 Gene:Awh / 38451 FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_572500.1 Gene:CG11294 / 31807 FlyBaseID:FBgn0030058 Length:261 Species:Drosophila melanogaster


Alignment Length:63 Identity:28/63 - (44%)
Similarity:38/63 - (60%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 YHKSKTKRVRTTFTEEQLQVLQANFQIDSNPDGQDLERIASVTGLSKRVTQVWFQNSRARQKK 205
            :.:.:.:|.|||||.:|||.|:|.||....||....|.:|....||:...||||||.||:.:|
  Fly    19 FGRRRQRRNRTTFTPQQLQELEALFQKTHYPDVFLREEVALRISLSEARVQVWFQNRRAKWRK 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759
LIM2_AWH 69..123 CDD:188765
Homeodomain 149..205 CDD:459649 27/55 (49%)
CG11294NP_572500.1 Homeodomain 29..81 CDD:459649 25/51 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.