DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Awh and Lhx6

DIOPT Version :9

Sequence 1:NP_001261379.1 Gene:Awh / 38451 FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001101307.2 Gene:Lhx6 / 311901 RGDID:1306174 Length:392 Species:Rattus norvegicus


Alignment Length:293 Identity:120/293 - (40%)
Similarity:157/293 - (53%) Gaps:65/293 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CAACGEPISDRFFLEVGGCSWHAHCLRCCMCMCPLDRQQSCFIRERQVYCKADYSKNFGAKCSKC 72
            |::||..|.||:.|:|....||..||.|.:|...|.:|.||:|:.:::|||.||...||.||::|
  Rat    99 CSSCGLEILDRYLLKVNNLIWHVRCLECSVCRTSLRQQNSCYIKNKEIYCKMDYFSRFGTKCARC 163

  Fly    73 CRGISASDWVRRARELVFHLACFACDQCGRQLSTGEQFALMDDRVLCKAHY---LE--------- 125
            .|.|.|||||||||...:|||||||..|.|||||||:|.|::::|||:.||   :|         
  Rat   164 GRQIYASDWVRRARGNAYHLACFACFSCKRQLSTGEEFGLVEEKVLCRIHYDTMIENLKRAAENG 228

  Fly   126 ---TVEGGTTSSDEGCDGDGYHKSKTKRVRTTFTEEQLQVLQANFQIDSNPDGQDLERIASVTGL 187
               |:||...|..:.      .....||.||:||.|||||:||.|..|:|||.|.|:::|.:|||
  Rat   229 NGLTLEGAVPSEQDS------QPKPAKRARTSFTAEQLQVMQAQFAQDNNPDAQTLQKLADMTGL 287

  Fly   188 SKRVTQVWFQNSRARQKKHIHAGKNKIREPEGSSFARHINLQLTYSFQNNAQNPMHLNGSKAGLY 252
            |:||.||||||.|||.|||                              ..|:|:..:|:.....
  Rat   288 SRRVIQVWFQNCRARHKKH------------------------------TPQHPVPPSGAPPSRL 322

  Fly   253 PTHESSMDELSQDSSVHCMPSEVXLEQSSPARA 285
            |:      .||.|  :|..|.      |||.||
  Rat   323 PS------SLSDD--IHYSPF------SSPERA 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759 22/52 (42%)
LIM2_AWH 69..123 CDD:188765 33/53 (62%)
Homeobox 152..204 CDD:278475 34/51 (67%)
Lhx6NP_001101307.2 LIM1_Lhx6 99..152 CDD:188766 22/52 (42%)
LIM2_Lhx6 160..214 CDD:188768 33/53 (62%)
Homeobox 252..305 CDD:395001 34/52 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I8157
eggNOG 1 0.900 - - E33208_3BHYC
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 223 1.000 Inparanoid score I3436
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1161127at2759
OrthoFinder 1 1.000 - - FOG0001821
OrthoInspector 1 1.000 - - otm45500
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24208
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1183
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.