DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Awh and Zfhx3

DIOPT Version :9

Sequence 1:	NP_001261379.1	Gene:	Awh / 38451	FlyBaseID:	FBgn0013751	Length:	287	Species:	Drosophila melanogaster
Sequence 2:	XP_038954238.1	Gene:	Zfhx3 / 307829	RGDID:	1560268	Length:	3730	Species:	Rattus norvegicus

Alignment Length:	81	Identity:	35/81 - (43%)
Similarity:	49/81 - (60%)	Gaps:	0/81 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   125 ETVEGGTTSSDEGCDGDGYHKSKTKRVRTTFTEEQLQVLQANFQIDSNPDGQDLERIASVTGLSK 189
            |...|.:...::.....|....:.||:|||.|.|||::|...:.:||||..:.|:.||...||.|
  Rat  2630 EKASGASPGENDSSGTGGEEPQRDKRLRTTITPEQLEILYQKYLLDSNPTRKMLDHIAHEVGLKK 2694

  Fly   190 RVTQVWFQNSRARQKK 205
            ||.||||||:|||::|
  Rat  2695 RVVQVWFQNTRARERK 2710

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Awh	NP_001261379.1	LIM1_AWH	8..61	CDD:188759
		LIM2_AWH	69..123	CDD:188765
		Homeobox	152..204	CDD:278475	29/51 (57%)
Zfhx3	XP_038954238.1	C2H2 Zn finger	672..692	CDD:275368
		C2H2 Zn finger	727..744	CDD:275368
		C2H2 Zn finger	1374..1394	CDD:275368
		C2H2 Zn finger	1412..1432	CDD:275371
		C2H2 Zn finger	1440..1461	CDD:275371
		C2H2 Zn finger	1556..1580	CDD:275368
		C2H2 Zn finger	1607..1625	CDD:275368
		HOX	2156..2212	CDD:197696
		Homeobox	2256..2310	CDD:395001
		COG5576	2604..2750	CDD:227863	35/81 (43%)
		Homeobox	2657..2710	CDD:395001	29/52 (56%)
		Homeobox	2961..3014	CDD:395001
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	1	1.000