DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Awh and Lhx2

DIOPT Version :9

Sequence 1:NP_001261379.1 Gene:Awh / 38451 FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster
Sequence 2:XP_006234134.1 Gene:Lhx2 / 296706 RGDID:71076 Length:414 Species:Rattus norvegicus


Alignment Length:369 Identity:105/369 - (28%)
Similarity:162/369 - (43%) Gaps:106/369 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CAACGEPISDRFFLEVGGCSWHAHCLRCCMCMCPLDRQQSCFIRERQVYCKADY--------SKN 64
            ||.||..||||::|......||..||:||.|...|:.:.:||.::..:|||.||        .:.
  Rat    53 CAGCGGKISDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYSPSLHGPHRR 117

  Fly    65 FGA-KCSKCCRGISASDWVRRARELVFHLACFACDQCGRQLSTGEQFALMDDRVLCKAHYLETVE 128
            |.. :|::|..|||||:.|.|||:||:||.||.|..|.:.|:||:.|.:.|..|.|:.|:...::
  Rat   118 FSVQRCARCHLGISASEMVMRARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYCRLHFEALLQ 182

  Fly   129 G------------------------------------------GTT---------SSDEGCD--- 139
            |                                          ||.         |...|.|   
  Rat   183 GEYPAHFNHADVAAAAAAAAAAKSAGLGSAGANPLGLPYYNGVGTVQKGRPRKRKSPGPGADLAA 247

  Fly   140 ---------GDGYH---------KSKTKRVRTTFTEEQLQVLQANFQIDSNPDGQDLERIASVTG 186
                     .|..|         ..||||:||:|...||:.:::.|.|:.|||.:||:::|..||
  Rat   248 YNAALSCNENDAEHLDRDQPYPSSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTG 312

  Fly   187 LSKRVTQVWFQNSRARQKKHI----HAGKNKIRE-------PEGSSFARHINLQLTYSFQNNAQN 240
            |:|||.||||||:||:.::::    :.|.:|..:       |.|.:      .:|:.:..:.:..
  Rat   313 LTKRVLQVWFQNARAKFRRNLLRQENTGVDKTSDATLQTGTPSGPA------SELSNASLSPSST 371

  Fly   241 PMHLNGSKAGLYPTHESSMDELSQDSSVHCMPSEVXLEQSSPAR 284
            |..|....:...||..|.:..:..:...|        |..||::
  Rat   372 PTTLTDLTSPTLPTVTSVLTSVPGNLEGH--------EPHSPSQ 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759 22/52 (42%)
LIM2_AWH 69..123 CDD:188765 26/53 (49%)
Homeobox 152..204 CDD:278475 27/51 (53%)
Lhx2XP_006234134.1 LIM1_Lhx2 43..106 CDD:188853 22/52 (42%)
LIM2_Lhx2_Lhx9 119..177 CDD:188763 26/57 (46%)
COG5576 <255..386 CDD:227863 41/136 (30%)
Homeobox 278..331 CDD:395001 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.