DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Awh and lmo1

DIOPT Version :9

Sequence 1:NP_001261379.1 Gene:Awh / 38451 FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster
Sequence 2:XP_021333063.1 Gene:lmo1 / 280646 ZFINID:ZDB-GENE-021115-6 Length:179 Species:Danio rerio


Alignment Length:127 Identity:45/127 - (35%)
Similarity:68/127 - (53%) Gaps:3/127 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KTELRSCAACGEPISDRFFLEVGGCSWHAHCLRCCMCMCPLDRQQS-CFIRERQVYCKADYSKNF 65
            |.:.:.||.|...|.||:.|:.....||..||:|..|.|.|....| .:.:...:.|:.||.:.|
Zfish    41 KGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLF 105

  Fly    66 G--AKCSKCCRGISASDWVRRARELVFHLACFACDQCGRQLSTGEQFALMDDRVLCKAHYLE 125
            |  ..|:.|.:.|.|.:.|.|||:.|:||.||||..|.::...|::|.|.::.:||:..|.|
Zfish   106 GTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEE 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759 17/53 (32%)
LIM2_AWH 69..123 CDD:188765 21/53 (40%)
Homeobox 152..204 CDD:278475
lmo1XP_021333063.1 LIM1_LMO1_LMO3 47..101 CDD:188774 17/53 (32%)
LIM2_LMO1_LMO3 111..165 CDD:188775 21/53 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.