DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Awh and PDLIM3

DIOPT Version :9

Sequence 1:NP_001261379.1 Gene:Awh / 38451 FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_055291.2 Gene:PDLIM3 / 27295 HGNCID:20767 Length:364 Species:Homo sapiens


Alignment Length:71 Identity:21/71 - (29%)
Similarity:28/71 - (39%) Gaps:8/71 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 CSKCCRGISASDWVRRARELVFHLACFACDQCGRQLSTGEQFALMDDRVLCKAHYLETVEGGTTS 133
            |.||..||..:  |.:||:...|..||.|..|...|.....| .::..:.|:.|     ....|.
Human   294 CDKCGSGIVGA--VVKARDKYRHPECFVCADCNLNLKQKGYF-FIEGELYCETH-----ARARTK 350

  Fly   134 SDEGCD 139
            ..||.|
Human   351 PPEGYD 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759
LIM2_AWH 69..123 CDD:188765 16/53 (30%)
Homeobox 152..204 CDD:278475
PDLIM3NP_055291.2 PDZ_signaling 2..80 CDD:238492
DUF4749 184..263 CDD:374237
LIM_ALP 294..346 CDD:188834 17/59 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.