powered by:
Protein Alignment Awh and PDLIM3
DIOPT Version :9
Sequence 1: | NP_001261379.1 |
Gene: | Awh / 38451 |
FlyBaseID: | FBgn0013751 |
Length: | 287 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_055291.2 |
Gene: | PDLIM3 / 27295 |
HGNCID: | 20767 |
Length: | 364 |
Species: | Homo sapiens |
Alignment Length: | 71 |
Identity: | 21/71 - (29%) |
Similarity: | 28/71 - (39%) |
Gaps: | 8/71 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 69 CSKCCRGISASDWVRRARELVFHLACFACDQCGRQLSTGEQFALMDDRVLCKAHYLETVEGGTTS 133
|.||..||..: |.:||:...|..||.|..|...|.....| .::..:.|:.| ....|.
Human 294 CDKCGSGIVGA--VVKARDKYRHPECFVCADCNLNLKQKGYF-FIEGELYCETH-----ARARTK 350
Fly 134 SDEGCD 139
..||.|
Human 351 PPEGYD 356
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R6207 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.